Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395MFU3

Protein Details
Accession A0A395MFU3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-66EVPTRKRAIAQQQQKQQKKKNKQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, extr 7, plas 4, mito_nucl 4, E.R. 3
Family & Domain DBs
Amino Acid Sequences MKFTLFTLITLVTAASAGLIKRVDVNVPAMTDATGRVVEFNAAEVPTRKRAIAQQQQKQQKKKNKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.05
4 0.05
5 0.07
6 0.07
7 0.07
8 0.09
9 0.09
10 0.1
11 0.1
12 0.12
13 0.11
14 0.11
15 0.11
16 0.1
17 0.1
18 0.09
19 0.08
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.06
26 0.05
27 0.06
28 0.06
29 0.06
30 0.07
31 0.1
32 0.13
33 0.18
34 0.19
35 0.18
36 0.19
37 0.26
38 0.36
39 0.44
40 0.51
41 0.55
42 0.64
43 0.75
44 0.82
45 0.85
46 0.85