Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395M725

Protein Details
Accession A0A395M725    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-71QEHYRKEHGWRNPRGRGRRIMHBasic
214-235EVQRKEVDKKPRRPFDNRVEEDBasic
NLS Segment(s)
PositionSequence
59-68WRNPRGRGRR
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 6.5, pero 4
Family & Domain DBs
Gene Ontology GO:0004386  F:helicase activity  
Amino Acid Sequences MIGDQRGLLTWQKPPPTIDPIPHIHPPVADKLGCDEEGCLFVVGTPRGMQEHYRKEHGWRNPRGRGRRIMHKPIDPIEVPWRTGVQSQRLFNNGPGSGWFEVGFGAAATQTPDEAAMMERAVHAMKQKQEQFEREDKECIKAADAKTDANAWLERVGWANHLQGLDPEAMRQLMDPVGEDEHVLQLMQDSIMRVMLQARMTATPNTVGTQALFEVQRKEVDKKPRRPFDNRVEEDTWARYTGVWSKLICYIYRAEGMPDGKRPGFRLTKQQGDRIDALELTIKDHIDDPEANPLDKDEVNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.49
5 0.46
6 0.46
7 0.46
8 0.48
9 0.49
10 0.46
11 0.38
12 0.36
13 0.35
14 0.35
15 0.34
16 0.3
17 0.25
18 0.28
19 0.3
20 0.29
21 0.26
22 0.2
23 0.16
24 0.17
25 0.18
26 0.13
27 0.09
28 0.1
29 0.15
30 0.14
31 0.14
32 0.13
33 0.13
34 0.15
35 0.16
36 0.21
37 0.26
38 0.35
39 0.39
40 0.44
41 0.44
42 0.5
43 0.57
44 0.6
45 0.61
46 0.62
47 0.67
48 0.71
49 0.79
50 0.81
51 0.8
52 0.8
53 0.76
54 0.77
55 0.77
56 0.78
57 0.75
58 0.71
59 0.68
60 0.61
61 0.6
62 0.5
63 0.43
64 0.42
65 0.37
66 0.33
67 0.29
68 0.27
69 0.22
70 0.26
71 0.27
72 0.27
73 0.31
74 0.33
75 0.35
76 0.37
77 0.37
78 0.34
79 0.35
80 0.26
81 0.21
82 0.19
83 0.21
84 0.18
85 0.17
86 0.15
87 0.11
88 0.1
89 0.1
90 0.09
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.07
110 0.09
111 0.12
112 0.16
113 0.22
114 0.26
115 0.31
116 0.34
117 0.37
118 0.4
119 0.43
120 0.44
121 0.39
122 0.4
123 0.35
124 0.34
125 0.33
126 0.27
127 0.21
128 0.22
129 0.2
130 0.21
131 0.21
132 0.19
133 0.17
134 0.18
135 0.17
136 0.13
137 0.13
138 0.08
139 0.07
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.09
146 0.09
147 0.11
148 0.11
149 0.1
150 0.09
151 0.1
152 0.09
153 0.08
154 0.08
155 0.07
156 0.07
157 0.07
158 0.07
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.07
168 0.06
169 0.06
170 0.06
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.05
180 0.05
181 0.06
182 0.09
183 0.09
184 0.09
185 0.1
186 0.11
187 0.13
188 0.14
189 0.13
190 0.13
191 0.13
192 0.13
193 0.13
194 0.11
195 0.1
196 0.1
197 0.09
198 0.1
199 0.1
200 0.11
201 0.13
202 0.14
203 0.18
204 0.2
205 0.25
206 0.29
207 0.4
208 0.48
209 0.57
210 0.66
211 0.72
212 0.76
213 0.79
214 0.82
215 0.81
216 0.82
217 0.76
218 0.72
219 0.65
220 0.6
221 0.54
222 0.48
223 0.38
224 0.28
225 0.24
226 0.17
227 0.17
228 0.22
229 0.23
230 0.24
231 0.22
232 0.23
233 0.28
234 0.3
235 0.28
236 0.23
237 0.22
238 0.21
239 0.24
240 0.22
241 0.19
242 0.22
243 0.25
244 0.26
245 0.28
246 0.31
247 0.3
248 0.32
249 0.33
250 0.37
251 0.42
252 0.43
253 0.49
254 0.52
255 0.6
256 0.62
257 0.66
258 0.62
259 0.59
260 0.58
261 0.48
262 0.42
263 0.32
264 0.28
265 0.27
266 0.23
267 0.19
268 0.19
269 0.18
270 0.17
271 0.19
272 0.19
273 0.18
274 0.2
275 0.19
276 0.28
277 0.3
278 0.29
279 0.26
280 0.27
281 0.27