Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LKY0

Protein Details
Accession E2LKY0   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-69ASIKAERQARKKKRIVRLLLHydrophilic
NLS Segment(s)
PositionSequence
57-63QARKKKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
KEGG mpr:MPER_07358  -  
Amino Acid Sequences MWGSPQSSPPPSDDPLDEVLKPPPDETPEQAAIRIKQENEARQISMAIDASIKAERQARKKKRIVRLLLLGQSESGGSHDELSGLSEEAYHDLLVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.31
4 0.26
5 0.23
6 0.25
7 0.26
8 0.25
9 0.22
10 0.2
11 0.22
12 0.24
13 0.26
14 0.28
15 0.28
16 0.28
17 0.3
18 0.3
19 0.28
20 0.28
21 0.28
22 0.22
23 0.23
24 0.27
25 0.29
26 0.31
27 0.31
28 0.28
29 0.25
30 0.25
31 0.19
32 0.16
33 0.12
34 0.07
35 0.06
36 0.05
37 0.06
38 0.07
39 0.06
40 0.07
41 0.12
42 0.17
43 0.27
44 0.38
45 0.46
46 0.56
47 0.64
48 0.71
49 0.76
50 0.81
51 0.78
52 0.74
53 0.72
54 0.68
55 0.64
56 0.56
57 0.46
58 0.36
59 0.3
60 0.23
61 0.15
62 0.1
63 0.08
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.1
70 0.1
71 0.08
72 0.08
73 0.07
74 0.08
75 0.1
76 0.11