Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395N138

Protein Details
Accession A0A395N138    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-52RVNNVKSKYCSKCRRKRCVKAKAMNYKGEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001876  Znf_RanBP2  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01358  ZF_RANBP2_1  
Amino Acid Sequences MAIQDPKDRPDHTQWLCTNIGCHRVNNVKSKYCSKCRRKRCVKAKAMNYKGERLGELTKVDDGVEVWEYKDEELSSTHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.49
4 0.43
5 0.38
6 0.3
7 0.35
8 0.28
9 0.27
10 0.28
11 0.34
12 0.38
13 0.45
14 0.47
15 0.45
16 0.48
17 0.56
18 0.57
19 0.59
20 0.66
21 0.68
22 0.72
23 0.76
24 0.84
25 0.86
26 0.9
27 0.9
28 0.9
29 0.89
30 0.89
31 0.88
32 0.88
33 0.82
34 0.79
35 0.71
36 0.64
37 0.56
38 0.48
39 0.38
40 0.3
41 0.27
42 0.21
43 0.2
44 0.18
45 0.16
46 0.15
47 0.15
48 0.12
49 0.1
50 0.1
51 0.11
52 0.1
53 0.1
54 0.12
55 0.12
56 0.13
57 0.14
58 0.13
59 0.12