Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MT18

Protein Details
Accession A0A395MT18    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-33PLPPTNKRPTHKSIPKHHKHHPSQTCCCKILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MQPLPPTNKRPTHKSIPKHHKHHPSQTCCCKILISRESIVDEKRTEGNIPNAVQTCKSTRELSALWFCRDWKFDELEHAFGFGYSEEAEEAWDDGEGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.8
4 0.84
5 0.84
6 0.86
7 0.85
8 0.84
9 0.86
10 0.85
11 0.83
12 0.83
13 0.85
14 0.81
15 0.71
16 0.63
17 0.53
18 0.46
19 0.45
20 0.39
21 0.32
22 0.28
23 0.28
24 0.3
25 0.3
26 0.28
27 0.22
28 0.18
29 0.17
30 0.17
31 0.16
32 0.15
33 0.16
34 0.18
35 0.19
36 0.19
37 0.19
38 0.19
39 0.19
40 0.18
41 0.18
42 0.17
43 0.16
44 0.19
45 0.18
46 0.17
47 0.2
48 0.2
49 0.23
50 0.29
51 0.29
52 0.28
53 0.28
54 0.28
55 0.28
56 0.29
57 0.28
58 0.23
59 0.23
60 0.22
61 0.3
62 0.31
63 0.32
64 0.3
65 0.26
66 0.23
67 0.2
68 0.2
69 0.11
70 0.09
71 0.06
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07