FuNGI

A0A395N5G2

Protein Details

Accession

A0A395N5G2

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
405-426	MARSKASKGSKNRKATPQPATA	Hydrophilic
491-514	EYRDEDTLKVRARKKRRDRRRSKK	Basic

NLS Segment(s)

Position	Sequence
407-447	RSKASKGSKNRKATPQPATARAPRPVKAPPAPKPPEPPREF
500-514	VRARKKRRDRRRSKK

Subcellular Location(s)

nucl 20, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR038988 Sas4 IPR029184 Sas4_dom
Gene Ontology	GO:0033255 C:SAS acetyltransferase complex GO:0016573 P:histone acetylation
Pfam	View protein in Pfam PF15460 SAS4

Amino Acid Sequences

MASVTRSSRRAEVPHQHHHSHHHLPSPASVFAHAQGGGVGAGGASGAGRNKRALDAHDRDFDAIKPKKSRITVEIPARGSQKLRVADIDNSEAPPPTRQPAATPTVASATTPNIPPTSTDNATSKPKQEQTLTKHQSKVINGIKHELDRLQPQPSDTNTKEQGRKLRSQEANRFKSELSAYFSDYDEVIGNEPKEQQLFNVDTPIVIVDSDPRRAVSDNQRAIPNPATEYPVRGYGDALFYNVFDCQLVDLGFFQSRSNKTVEDPLPDKLFQPIHRRAERLERSVRNAEKGRAQHEKDHIIRLLEGLQGHDWLRVMGVSGVTETKKKTFEPARNHFIKGCQAVLNKYRNYVLEEKRRKMEKDRARAEKEHEEDSSVGEDETGDEADDSNASDLASPAKQLQEEAMARSKASKGSKNRKATPQPATARAPRPVKAPPAPKPPEPPREFKSFFTKRYERDTALNRNRRTGRKVLAWGLPIPEIPEVDFDLPEEYRDEDTLKVRARKKRRDRRRSKK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.67
2	0.71
3	0.7
4	0.68
5	0.69
6	0.67
7	0.66
8	0.62
9	0.59
10	0.56
11	0.52
12	0.55
13	0.51
14	0.45
15	0.37
16	0.33
17	0.27
18	0.24
19	0.25
20	0.19
21	0.15
22	0.13
23	0.12
24	0.11
25	0.09
26	0.07
27	0.04
28	0.04
29	0.03
30	0.03
31	0.03
32	0.04
33	0.08
34	0.11
35	0.13
36	0.16
37	0.17
38	0.21
39	0.24
40	0.28
41	0.35
42	0.39
43	0.43
44	0.47
45	0.46
46	0.44
47	0.43
48	0.4
49	0.4
50	0.39
51	0.41
52	0.42
53	0.45
54	0.51
55	0.55
56	0.58
57	0.55
58	0.57
59	0.58
60	0.61
61	0.64
62	0.59
63	0.58
64	0.55
65	0.5
66	0.43
67	0.39
68	0.37
69	0.32
70	0.32
71	0.31
72	0.32
73	0.34
74	0.36
75	0.36
76	0.3
77	0.29
78	0.28
79	0.25
80	0.23
81	0.22
82	0.21
83	0.19
84	0.21
85	0.2
86	0.22
87	0.27
88	0.32
89	0.3
90	0.28
91	0.26
92	0.25
93	0.25
94	0.22
95	0.17
96	0.14
97	0.15
98	0.16
99	0.17
100	0.15
101	0.15
102	0.17
103	0.21
104	0.25
105	0.24
106	0.26
107	0.26
108	0.3
109	0.38
110	0.39
111	0.37
112	0.38
113	0.41
114	0.42
115	0.46
116	0.51
117	0.51
118	0.59
119	0.62
120	0.61
121	0.59
122	0.59
123	0.59
124	0.52
125	0.53
126	0.5
127	0.47
128	0.43
129	0.44
130	0.41
131	0.37
132	0.37
133	0.29
134	0.24
135	0.25
136	0.26
137	0.26
138	0.25
139	0.26
140	0.29
141	0.3
142	0.36
143	0.32
144	0.36
145	0.38
146	0.44
147	0.47
148	0.47
149	0.53
150	0.51
151	0.56
152	0.55
153	0.59
154	0.6
155	0.64
156	0.69
157	0.71
158	0.7
159	0.65
160	0.61
161	0.51
162	0.47
163	0.4
164	0.32
165	0.27
166	0.23
167	0.23
168	0.22
169	0.22
170	0.19
171	0.17
172	0.15
173	0.1
174	0.09
175	0.09
176	0.1
177	0.1
178	0.1
179	0.11
180	0.11
181	0.12
182	0.11
183	0.1
184	0.13
185	0.16
186	0.15
187	0.16
188	0.15
189	0.14
190	0.14
191	0.14
192	0.09
193	0.06
194	0.06
195	0.09
196	0.11
197	0.13
198	0.13
199	0.13
200	0.14
201	0.15
202	0.21
203	0.26
204	0.34
205	0.36
206	0.38
207	0.39
208	0.39
209	0.4
210	0.38
211	0.28
212	0.21
213	0.19
214	0.19
215	0.18
216	0.19
217	0.17
218	0.18
219	0.18
220	0.16
221	0.15
222	0.13
223	0.15
224	0.13
225	0.12
226	0.09
227	0.08
228	0.08
229	0.08
230	0.07
231	0.05
232	0.04
233	0.04
234	0.05
235	0.05
236	0.04
237	0.05
238	0.06
239	0.06
240	0.07
241	0.07
242	0.11
243	0.13
244	0.15
245	0.16
246	0.15
247	0.16
248	0.23
249	0.24
250	0.24
251	0.24
252	0.25
253	0.25
254	0.25
255	0.25
256	0.2
257	0.22
258	0.22
259	0.29
260	0.34
261	0.4
262	0.42
263	0.43
264	0.42
265	0.49
266	0.49
267	0.47
268	0.48
269	0.42
270	0.45
271	0.52
272	0.51
273	0.46
274	0.44
275	0.4
276	0.37
277	0.37
278	0.37
279	0.38
280	0.39
281	0.39
282	0.41
283	0.46
284	0.42
285	0.43
286	0.39
287	0.32
288	0.3
289	0.24
290	0.21
291	0.15
292	0.13
293	0.1
294	0.09
295	0.1
296	0.1
297	0.1
298	0.09
299	0.07
300	0.07
301	0.06
302	0.06
303	0.05
304	0.05
305	0.05
306	0.05
307	0.07
308	0.08
309	0.1
310	0.11
311	0.13
312	0.15
313	0.15
314	0.23
315	0.3
316	0.38
317	0.47
318	0.53
319	0.59
320	0.6
321	0.62
322	0.55
323	0.48
324	0.46
325	0.37
326	0.31
327	0.26
328	0.25
329	0.28
330	0.34
331	0.38
332	0.33
333	0.33
334	0.33
335	0.3
336	0.34
337	0.37
338	0.39
339	0.43
340	0.51
341	0.54
342	0.59
343	0.64
344	0.62
345	0.62
346	0.64
347	0.63
348	0.65
349	0.7
350	0.72
351	0.73
352	0.73
353	0.71
354	0.7
355	0.63
356	0.55
357	0.46
358	0.39
359	0.33
360	0.3
361	0.26
362	0.17
363	0.13
364	0.1
365	0.1
366	0.08
367	0.09
368	0.08
369	0.06
370	0.06
371	0.06
372	0.07
373	0.07
374	0.06
375	0.06
376	0.06
377	0.06
378	0.06
379	0.06
380	0.08
381	0.09
382	0.09
383	0.1
384	0.12
385	0.12
386	0.12
387	0.13
388	0.17
389	0.18
390	0.21
391	0.26
392	0.24
393	0.24
394	0.26
395	0.27
396	0.26
397	0.31
398	0.36
399	0.41
400	0.51
401	0.61
402	0.69
403	0.75
404	0.79
405	0.83
406	0.83
407	0.8
408	0.79
409	0.75
410	0.72
411	0.71
412	0.69
413	0.65
414	0.64
415	0.61
416	0.52
417	0.51
418	0.5
419	0.52
420	0.53
421	0.56
422	0.57
423	0.63
424	0.67
425	0.67
426	0.72
427	0.73
428	0.75
429	0.71
430	0.7
431	0.65
432	0.69
433	0.67
434	0.61
435	0.62
436	0.59
437	0.59
438	0.61
439	0.64
440	0.58
441	0.64
442	0.66
443	0.58
444	0.59
445	0.63
446	0.64
447	0.68
448	0.73
449	0.66
450	0.69
451	0.74
452	0.73
453	0.71
454	0.69
455	0.66
456	0.65
457	0.69
458	0.66
459	0.63
460	0.59
461	0.54
462	0.48
463	0.42
464	0.33
465	0.28
466	0.23
467	0.18
468	0.16
469	0.15
470	0.16
471	0.16
472	0.16
473	0.14
474	0.17
475	0.16
476	0.16
477	0.16
478	0.15
479	0.16
480	0.17
481	0.18
482	0.18
483	0.22
484	0.28
485	0.35
486	0.41
487	0.47
488	0.56
489	0.65
490	0.73
491	0.81
492	0.85
493	0.88
494	0.92

A0A395N5G2

3D AlphaFold-predicted Structure Viewer