Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MEY1

Protein Details
Accession A0A395MEY1    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
132-161AAKLKWVRKLVKEKHKKATRPVKRREDEFFBasic
NLS Segment(s)
PositionSequence
134-156KLKWVRKLVKEKHKKATRPVKRR
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
Amino Acid Sequences MDSSAVDYWLECLMEKIESEPESGDISLQMLDDEYGKDLPLRRYAEDRIGPSVSRLEETTYAEYVAFLGWRLRGFNAVRLELYLRKFGPDSFSTSLGPASSDDTELAQSPSDHEQPTLYERRRGAIISILDAAKLKWVRKLVKEKHKKATRPVKRREDEFFDLYLKVLDLDSDSELHSSTEVPQIFRNFVFLKDRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.15
5 0.15
6 0.16
7 0.16
8 0.16
9 0.17
10 0.16
11 0.15
12 0.1
13 0.1
14 0.1
15 0.09
16 0.07
17 0.06
18 0.06
19 0.07
20 0.07
21 0.08
22 0.08
23 0.08
24 0.11
25 0.15
26 0.18
27 0.24
28 0.27
29 0.27
30 0.32
31 0.34
32 0.4
33 0.4
34 0.39
35 0.36
36 0.34
37 0.32
38 0.29
39 0.29
40 0.22
41 0.18
42 0.17
43 0.15
44 0.15
45 0.18
46 0.19
47 0.17
48 0.16
49 0.15
50 0.14
51 0.12
52 0.1
53 0.07
54 0.05
55 0.06
56 0.06
57 0.07
58 0.08
59 0.08
60 0.13
61 0.14
62 0.19
63 0.21
64 0.21
65 0.2
66 0.2
67 0.22
68 0.2
69 0.21
70 0.18
71 0.16
72 0.16
73 0.16
74 0.16
75 0.19
76 0.16
77 0.2
78 0.19
79 0.21
80 0.2
81 0.2
82 0.2
83 0.15
84 0.14
85 0.09
86 0.09
87 0.07
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08
93 0.08
94 0.06
95 0.06
96 0.08
97 0.11
98 0.12
99 0.12
100 0.12
101 0.12
102 0.13
103 0.18
104 0.25
105 0.23
106 0.26
107 0.26
108 0.27
109 0.28
110 0.27
111 0.23
112 0.2
113 0.19
114 0.15
115 0.17
116 0.15
117 0.15
118 0.14
119 0.13
120 0.14
121 0.16
122 0.15
123 0.18
124 0.25
125 0.29
126 0.38
127 0.49
128 0.53
129 0.62
130 0.72
131 0.76
132 0.8
133 0.84
134 0.81
135 0.81
136 0.83
137 0.83
138 0.82
139 0.85
140 0.85
141 0.82
142 0.81
143 0.77
144 0.75
145 0.7
146 0.62
147 0.54
148 0.45
149 0.39
150 0.34
151 0.27
152 0.19
153 0.13
154 0.09
155 0.08
156 0.07
157 0.08
158 0.09
159 0.1
160 0.1
161 0.1
162 0.11
163 0.11
164 0.1
165 0.09
166 0.1
167 0.16
168 0.17
169 0.18
170 0.23
171 0.26
172 0.28
173 0.28
174 0.31
175 0.26
176 0.28