Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MCN1

Protein Details
Accession A0A395MCN1    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-28PTCWNCGKKGHQEPECRNPVKHydrophilic
79-104EFRERCRKISEKSRKKNKQNWEPVPEHydrophilic
NLS Segment(s)
PositionSequence
90-94KSRKK
Subcellular Location(s) nucl 20, mito_nucl 12.833, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MRTGWLAPTCWNCGKKGHQEPECRNPVKTNQKYKPVPEDGQQPDPNYNALKDPEFMEKRQKDNWKHAEYIRQRKQNDPEFRERCRKISEKSRKKNKQNWEPVPETTKEVTTNGKRIAITRKERGPTPEPGSTLTPEEIREGLDKLMDETFSKLPIPQPDGTIKSLQETMGRTDDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.58
4 0.62
5 0.63
6 0.71
7 0.77
8 0.81
9 0.83
10 0.74
11 0.66
12 0.61
13 0.63
14 0.64
15 0.66
16 0.66
17 0.64
18 0.72
19 0.76
20 0.77
21 0.76
22 0.72
23 0.65
24 0.58
25 0.6
26 0.55
27 0.58
28 0.55
29 0.48
30 0.42
31 0.4
32 0.38
33 0.29
34 0.25
35 0.19
36 0.19
37 0.18
38 0.17
39 0.18
40 0.25
41 0.26
42 0.27
43 0.35
44 0.37
45 0.4
46 0.46
47 0.54
48 0.5
49 0.58
50 0.66
51 0.59
52 0.59
53 0.57
54 0.59
55 0.59
56 0.65
57 0.63
58 0.61
59 0.58
60 0.61
61 0.67
62 0.67
63 0.67
64 0.62
65 0.64
66 0.62
67 0.65
68 0.68
69 0.62
70 0.55
71 0.52
72 0.5
73 0.45
74 0.52
75 0.58
76 0.59
77 0.68
78 0.76
79 0.8
80 0.85
81 0.88
82 0.87
83 0.87
84 0.87
85 0.84
86 0.8
87 0.73
88 0.65
89 0.61
90 0.51
91 0.44
92 0.34
93 0.27
94 0.21
95 0.19
96 0.24
97 0.23
98 0.27
99 0.25
100 0.27
101 0.26
102 0.28
103 0.36
104 0.38
105 0.42
106 0.43
107 0.48
108 0.48
109 0.51
110 0.54
111 0.49
112 0.48
113 0.47
114 0.44
115 0.39
116 0.39
117 0.39
118 0.34
119 0.32
120 0.26
121 0.21
122 0.18
123 0.19
124 0.16
125 0.15
126 0.15
127 0.14
128 0.13
129 0.13
130 0.12
131 0.12
132 0.13
133 0.12
134 0.11
135 0.14
136 0.15
137 0.15
138 0.15
139 0.15
140 0.19
141 0.24
142 0.29
143 0.27
144 0.3
145 0.35
146 0.38
147 0.4
148 0.38
149 0.33
150 0.31
151 0.31
152 0.28
153 0.25
154 0.24
155 0.25