Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2R3X0

Protein Details
Accession A2R3X0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-49CVCIYFLIKHRRDRKRERREDNLRAQYYHydrophilic
NLS Segment(s)
PositionSequence
31-39HRRDRKRER
Subcellular Location(s) mito 11, plas 6, cyto 3.5, cyto_nucl 3.5, nucl 2.5, extr 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ang:ANI_1_788124  -  
Amino Acid Sequences MSIGKIIGKIIIIPILVIIFICVCIYFLIKHRRDRKRERREDNLRAQYYRQQFQQQYMYPHTQMQPQQQQQQPGTPAPPYYNHAYAVGQQPVAMNEGEYGYSESMMKKPEPVVYPVQQQHPGSEVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.06
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.06
13 0.08
14 0.15
15 0.25
16 0.31
17 0.4
18 0.5
19 0.59
20 0.68
21 0.78
22 0.82
23 0.83
24 0.89
25 0.88
26 0.89
27 0.89
28 0.88
29 0.87
30 0.86
31 0.77
32 0.68
33 0.61
34 0.58
35 0.53
36 0.47
37 0.39
38 0.37
39 0.35
40 0.37
41 0.41
42 0.37
43 0.35
44 0.37
45 0.36
46 0.3
47 0.31
48 0.28
49 0.26
50 0.26
51 0.29
52 0.33
53 0.34
54 0.4
55 0.41
56 0.45
57 0.41
58 0.41
59 0.37
60 0.3
61 0.28
62 0.21
63 0.2
64 0.17
65 0.18
66 0.18
67 0.2
68 0.2
69 0.2
70 0.2
71 0.2
72 0.21
73 0.24
74 0.22
75 0.17
76 0.16
77 0.16
78 0.15
79 0.16
80 0.13
81 0.08
82 0.07
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.08
89 0.09
90 0.1
91 0.12
92 0.15
93 0.15
94 0.16
95 0.19
96 0.24
97 0.26
98 0.29
99 0.34
100 0.35
101 0.44
102 0.46
103 0.49
104 0.5
105 0.48
106 0.45