Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MLK2

Protein Details
Accession A0A395MLK2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-78GICVECFTKKRERRKEKKLKEAEEDMNEHydrophilic
NLS Segment(s)
PositionSequence
59-70KKRERRKEKKLK
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, cysk 6
Family & Domain DBs
Amino Acid Sequences MCYALTISLSCEDCGKVIDFRKDYGLCRIGRRANFWGMCGDAKVEHQAHPGICVECFTKKRERRKEKKLKEAEEDMNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.21
5 0.28
6 0.28
7 0.29
8 0.35
9 0.34
10 0.34
11 0.37
12 0.37
13 0.32
14 0.34
15 0.39
16 0.38
17 0.38
18 0.41
19 0.37
20 0.38
21 0.36
22 0.33
23 0.28
24 0.24
25 0.22
26 0.18
27 0.14
28 0.08
29 0.08
30 0.12
31 0.12
32 0.11
33 0.13
34 0.15
35 0.14
36 0.15
37 0.17
38 0.13
39 0.12
40 0.13
41 0.13
42 0.17
43 0.19
44 0.22
45 0.31
46 0.38
47 0.49
48 0.59
49 0.69
50 0.74
51 0.83
52 0.91
53 0.91
54 0.94
55 0.94
56 0.9
57 0.87
58 0.84
59 0.8