Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MMP8

Protein Details
Accession A0A395MMP8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
305-331VSNWRVTKTFESRRLKKMKVKLLRRREHydrophilic
NLS Segment(s)
PositionSequence
317-331RRLKKMKVKLLRRRE
Subcellular Location(s) plas 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046536  DUF6601  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20246  DUF6601  
Amino Acid Sequences MASPPPPFTVRILERDFLGTTSSSAKEDFTNLLPASARFNDDIVTPTSDPNFLERELSVSRLTDVQEYLWMCGRLMPPRQLHHQRLISRDIVLSEQAELHMVWWRNRIFLKPMPKYLLDPSFWAANISDTAHLDDTTQGNLDTSARGFLFSYTALIAYKSDFRIAKEYGLLPEEVTWEGWKAFAAEVLENHRYDRVNPRYWYGELRLSRLNKIYAFRKGYLLRGYSRVASHTVYGDLIRDNFSVLAGILAYVVIALTAMQVGLGVDGLVEEQAFQNASYFLTVFALIVPLIGAIFIFLLVFVMIVSNWRVTKTFESRRLKKMKVKLLRRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.37
4 0.28
5 0.26
6 0.18
7 0.15
8 0.18
9 0.18
10 0.16
11 0.16
12 0.17
13 0.16
14 0.18
15 0.2
16 0.17
17 0.22
18 0.21
19 0.22
20 0.22
21 0.22
22 0.25
23 0.23
24 0.24
25 0.18
26 0.19
27 0.18
28 0.17
29 0.19
30 0.17
31 0.2
32 0.18
33 0.19
34 0.2
35 0.21
36 0.2
37 0.21
38 0.2
39 0.16
40 0.17
41 0.15
42 0.18
43 0.18
44 0.2
45 0.18
46 0.16
47 0.17
48 0.17
49 0.18
50 0.16
51 0.15
52 0.13
53 0.17
54 0.17
55 0.17
56 0.19
57 0.18
58 0.16
59 0.2
60 0.22
61 0.24
62 0.28
63 0.34
64 0.35
65 0.38
66 0.48
67 0.54
68 0.56
69 0.59
70 0.61
71 0.58
72 0.57
73 0.58
74 0.49
75 0.41
76 0.37
77 0.29
78 0.22
79 0.19
80 0.15
81 0.11
82 0.1
83 0.09
84 0.09
85 0.08
86 0.07
87 0.12
88 0.14
89 0.15
90 0.2
91 0.2
92 0.23
93 0.24
94 0.26
95 0.27
96 0.31
97 0.4
98 0.39
99 0.43
100 0.43
101 0.42
102 0.43
103 0.42
104 0.4
105 0.31
106 0.28
107 0.25
108 0.22
109 0.21
110 0.19
111 0.14
112 0.1
113 0.1
114 0.1
115 0.09
116 0.08
117 0.1
118 0.09
119 0.09
120 0.09
121 0.1
122 0.1
123 0.09
124 0.09
125 0.08
126 0.07
127 0.08
128 0.08
129 0.06
130 0.06
131 0.07
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.08
146 0.08
147 0.11
148 0.12
149 0.13
150 0.17
151 0.17
152 0.17
153 0.16
154 0.16
155 0.14
156 0.14
157 0.13
158 0.09
159 0.09
160 0.09
161 0.08
162 0.08
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.05
169 0.05
170 0.06
171 0.07
172 0.07
173 0.08
174 0.12
175 0.15
176 0.14
177 0.15
178 0.15
179 0.15
180 0.17
181 0.26
182 0.28
183 0.34
184 0.34
185 0.37
186 0.39
187 0.39
188 0.4
189 0.33
190 0.34
191 0.27
192 0.3
193 0.33
194 0.31
195 0.32
196 0.32
197 0.31
198 0.26
199 0.3
200 0.31
201 0.33
202 0.36
203 0.34
204 0.38
205 0.37
206 0.39
207 0.39
208 0.37
209 0.31
210 0.3
211 0.3
212 0.27
213 0.26
214 0.23
215 0.21
216 0.19
217 0.18
218 0.15
219 0.14
220 0.13
221 0.12
222 0.12
223 0.11
224 0.11
225 0.11
226 0.1
227 0.1
228 0.1
229 0.09
230 0.09
231 0.07
232 0.07
233 0.04
234 0.04
235 0.04
236 0.03
237 0.03
238 0.03
239 0.02
240 0.02
241 0.02
242 0.02
243 0.02
244 0.02
245 0.02
246 0.02
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.02
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.04
259 0.05
260 0.06
261 0.06
262 0.07
263 0.07
264 0.08
265 0.08
266 0.08
267 0.08
268 0.08
269 0.08
270 0.07
271 0.07
272 0.07
273 0.06
274 0.06
275 0.05
276 0.04
277 0.04
278 0.04
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.04
290 0.04
291 0.06
292 0.07
293 0.1
294 0.11
295 0.13
296 0.14
297 0.18
298 0.27
299 0.35
300 0.44
301 0.51
302 0.61
303 0.67
304 0.76
305 0.82
306 0.82
307 0.81
308 0.81
309 0.82
310 0.82
311 0.86