Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395N1B3

Protein Details
Accession A0A395N1B3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28VSAKKHVPIVKKRTKHFSRHQADRFMRHydrophilic
NLS Segment(s)
PositionSequence
10-48IVKKRTKHFSRHQADRFMRLDKGTWRKPKGIDSRVRRRF
Subcellular Location(s) mito 18, cyto 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKHFSRHQADRFMRLDKGTWRKPKGIDSRVRRRFRGTIAMPSIGYGSNKKTRYMMPSGHKAFLVSNIGDVELLLMHNRTHAAEIAHNVSSRKRVDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.81
4 0.81
5 0.81
6 0.81
7 0.83
8 0.83
9 0.82
10 0.77
11 0.74
12 0.67
13 0.59
14 0.51
15 0.42
16 0.38
17 0.37
18 0.43
19 0.45
20 0.51
21 0.53
22 0.55
23 0.57
24 0.64
25 0.65
26 0.64
27 0.65
28 0.65
29 0.72
30 0.77
31 0.8
32 0.72
33 0.68
34 0.62
35 0.57
36 0.56
37 0.48
38 0.45
39 0.43
40 0.42
41 0.36
42 0.32
43 0.29
44 0.2
45 0.18
46 0.12
47 0.13
48 0.19
49 0.2
50 0.21
51 0.22
52 0.23
53 0.27
54 0.3
55 0.33
56 0.31
57 0.39
58 0.4
59 0.39
60 0.37
61 0.32
62 0.28
63 0.24
64 0.22
65 0.13
66 0.11
67 0.1
68 0.1
69 0.09
70 0.09
71 0.07
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.09
82 0.1
83 0.11
84 0.14
85 0.16
86 0.17
87 0.18
88 0.18
89 0.19
90 0.23
91 0.23
92 0.22
93 0.21
94 0.23
95 0.28
96 0.36
97 0.43
98 0.46
99 0.49
100 0.48
101 0.46
102 0.45
103 0.42
104 0.39
105 0.33
106 0.3
107 0.35
108 0.43
109 0.5
110 0.49
111 0.5
112 0.47