Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MFX4

Protein Details
Accession A0A395MFX4    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AKSARASTRKANNRRLVQNVHydrophilic
77-109VDSAKKPSSGRIEKKRPDKRKQKSSKIVFKSYGHydrophilic
NLS Segment(s)
PositionSequence
81-121KKPSSGRIEKKRPDKRKQKSSKIVFKSYGSRSKAKGKKKSA
Subcellular Location(s) nucl 19, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASTRKANNRRLVQNVFGPAESARNERLSAKLLELAKQPKPESSDVNMNTQDEEVDHDSNENVQEDETSMDVDSAKKPSSGRIEKKRPDKRKQKSSKIVFKSYGSRSKAKGKKKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.8
4 0.74
5 0.67
6 0.63
7 0.57
8 0.49
9 0.4
10 0.34
11 0.26
12 0.25
13 0.22
14 0.2
15 0.17
16 0.17
17 0.18
18 0.18
19 0.2
20 0.2
21 0.19
22 0.18
23 0.2
24 0.2
25 0.21
26 0.25
27 0.28
28 0.28
29 0.31
30 0.31
31 0.28
32 0.32
33 0.31
34 0.3
35 0.29
36 0.34
37 0.31
38 0.34
39 0.33
40 0.29
41 0.27
42 0.23
43 0.19
44 0.11
45 0.12
46 0.1
47 0.1
48 0.1
49 0.09
50 0.09
51 0.1
52 0.11
53 0.08
54 0.06
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.06
64 0.07
65 0.08
66 0.1
67 0.11
68 0.12
69 0.12
70 0.18
71 0.27
72 0.36
73 0.44
74 0.52
75 0.62
76 0.69
77 0.8
78 0.85
79 0.86
80 0.87
81 0.89
82 0.89
83 0.9
84 0.92
85 0.92
86 0.92
87 0.93
88 0.92
89 0.89
90 0.86
91 0.79
92 0.72
93 0.69
94 0.66
95 0.65
96 0.59
97 0.57
98 0.54
99 0.61
100 0.65
101 0.67