Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395MNU0

Protein Details
Accession A0A395MNU0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
209-233APRMSTGRRAPKRKNPPLKLDRQIKHydrophilic
NLS Segment(s)
PositionSequence
215-245GRRAPKRKNPPLKLDRQIKRRTRADVRSVRL
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MLLSPTRSPTPSVSEGPLRRSASEPPFGPITPSASQQSLEAAEHQTRPPLSLSRDESIDDAIERVPFNLAQMVVNMQEYYTSELAAERQRTDDLTRQNEEMLRKVNDMDKRLQMHVVLMDGFVGFMREVKQGQAELAIAREFGGVHLQEVKELANSSVGIQQSLEPAPPSSRDDTSDEQRSVRFEEEEIRPIVEELFDQLPPTPIIDEAPRMSTGRRAPKRKNPPLKLDRQIKRRTRADVRSVRLRGRAWTPINAGHESERGEDDQDYSPDAEDEEDEPPIVTRASPSPSPSESDIEKPRYTVSRSVAPRHAQGPPGKPFKYHRMPKTVAAVWQEWKIGSYGNPAIEELEAKYNTTWRMGTLQERKYASNHVGVRQKIVRKVEDMCEELGIQTEEACEMLDRRVDGRMQLLMTALRKGEDPLVVIPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.49
4 0.53
5 0.48
6 0.45
7 0.44
8 0.47
9 0.45
10 0.48
11 0.44
12 0.4
13 0.41
14 0.39
15 0.39
16 0.33
17 0.32
18 0.26
19 0.29
20 0.28
21 0.26
22 0.26
23 0.23
24 0.24
25 0.2
26 0.19
27 0.18
28 0.19
29 0.22
30 0.24
31 0.25
32 0.27
33 0.25
34 0.26
35 0.27
36 0.28
37 0.29
38 0.34
39 0.38
40 0.36
41 0.37
42 0.36
43 0.34
44 0.3
45 0.26
46 0.19
47 0.14
48 0.12
49 0.13
50 0.12
51 0.12
52 0.12
53 0.11
54 0.12
55 0.13
56 0.13
57 0.11
58 0.12
59 0.13
60 0.12
61 0.12
62 0.11
63 0.08
64 0.09
65 0.09
66 0.13
67 0.12
68 0.11
69 0.1
70 0.11
71 0.15
72 0.2
73 0.21
74 0.18
75 0.19
76 0.2
77 0.22
78 0.26
79 0.29
80 0.31
81 0.35
82 0.37
83 0.36
84 0.38
85 0.39
86 0.38
87 0.35
88 0.33
89 0.28
90 0.27
91 0.28
92 0.31
93 0.33
94 0.35
95 0.35
96 0.36
97 0.37
98 0.37
99 0.37
100 0.31
101 0.27
102 0.24
103 0.2
104 0.14
105 0.1
106 0.09
107 0.08
108 0.07
109 0.05
110 0.05
111 0.04
112 0.05
113 0.07
114 0.09
115 0.09
116 0.1
117 0.12
118 0.11
119 0.12
120 0.12
121 0.1
122 0.09
123 0.1
124 0.09
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.09
131 0.07
132 0.08
133 0.12
134 0.11
135 0.11
136 0.12
137 0.12
138 0.1
139 0.1
140 0.1
141 0.07
142 0.08
143 0.08
144 0.11
145 0.11
146 0.1
147 0.1
148 0.1
149 0.12
150 0.12
151 0.11
152 0.08
153 0.09
154 0.1
155 0.12
156 0.14
157 0.15
158 0.16
159 0.18
160 0.22
161 0.25
162 0.3
163 0.34
164 0.32
165 0.3
166 0.3
167 0.28
168 0.26
169 0.23
170 0.18
171 0.13
172 0.18
173 0.19
174 0.21
175 0.2
176 0.18
177 0.16
178 0.16
179 0.15
180 0.1
181 0.08
182 0.07
183 0.08
184 0.08
185 0.08
186 0.08
187 0.09
188 0.09
189 0.09
190 0.07
191 0.06
192 0.07
193 0.07
194 0.09
195 0.08
196 0.09
197 0.1
198 0.1
199 0.1
200 0.14
201 0.19
202 0.28
203 0.36
204 0.42
205 0.49
206 0.59
207 0.7
208 0.76
209 0.81
210 0.77
211 0.8
212 0.8
213 0.82
214 0.8
215 0.79
216 0.76
217 0.75
218 0.78
219 0.75
220 0.75
221 0.71
222 0.7
223 0.68
224 0.68
225 0.69
226 0.67
227 0.65
228 0.65
229 0.64
230 0.59
231 0.54
232 0.48
233 0.41
234 0.36
235 0.39
236 0.32
237 0.32
238 0.31
239 0.31
240 0.33
241 0.31
242 0.28
243 0.22
244 0.21
245 0.19
246 0.18
247 0.16
248 0.13
249 0.13
250 0.12
251 0.14
252 0.14
253 0.13
254 0.13
255 0.12
256 0.12
257 0.1
258 0.1
259 0.08
260 0.07
261 0.08
262 0.08
263 0.08
264 0.08
265 0.08
266 0.08
267 0.08
268 0.07
269 0.06
270 0.06
271 0.09
272 0.13
273 0.14
274 0.16
275 0.2
276 0.21
277 0.24
278 0.24
279 0.25
280 0.23
281 0.28
282 0.33
283 0.35
284 0.34
285 0.32
286 0.32
287 0.33
288 0.34
289 0.33
290 0.3
291 0.33
292 0.37
293 0.42
294 0.46
295 0.45
296 0.45
297 0.43
298 0.42
299 0.39
300 0.41
301 0.43
302 0.44
303 0.5
304 0.47
305 0.48
306 0.5
307 0.55
308 0.59
309 0.61
310 0.6
311 0.61
312 0.64
313 0.64
314 0.66
315 0.59
316 0.53
317 0.48
318 0.43
319 0.36
320 0.35
321 0.32
322 0.24
323 0.22
324 0.18
325 0.15
326 0.13
327 0.16
328 0.17
329 0.18
330 0.18
331 0.18
332 0.18
333 0.17
334 0.17
335 0.13
336 0.16
337 0.15
338 0.16
339 0.16
340 0.19
341 0.2
342 0.21
343 0.2
344 0.15
345 0.19
346 0.21
347 0.3
348 0.36
349 0.39
350 0.44
351 0.46
352 0.46
353 0.45
354 0.47
355 0.41
356 0.4
357 0.39
358 0.39
359 0.45
360 0.44
361 0.48
362 0.49
363 0.52
364 0.51
365 0.54
366 0.5
367 0.46
368 0.5
369 0.5
370 0.49
371 0.45
372 0.39
373 0.34
374 0.31
375 0.27
376 0.24
377 0.18
378 0.13
379 0.1
380 0.1
381 0.09
382 0.08
383 0.09
384 0.07
385 0.08
386 0.1
387 0.13
388 0.14
389 0.15
390 0.18
391 0.19
392 0.2
393 0.22
394 0.23
395 0.21
396 0.2
397 0.21
398 0.21
399 0.22
400 0.23
401 0.2
402 0.17
403 0.18
404 0.19
405 0.21
406 0.19
407 0.2
408 0.22