Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395N762

Protein Details
Accession A0A395N762    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-68DLERRLKKRRAAEEEEERRRLBasic
NLS Segment(s)
PositionSequence
51-58RRLKKRRA
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022617  Rad60/SUMO-like_dom  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF11976  Rad60-SLD  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd01763  Ubl_SUMO_like  
Amino Acid Sequences MKKLPFKPTALRKAAPKPSEPEEAKESDDDGLALFRRRKEMAPIMAADLERRLKKRRAAEEEEERRRLQTTGEKRTRDDSEDAKDSEILSQGEPSNAQEGPSSVQLSNETPVAEPASTQDGADQTRFASLLHNLRPPSDQASELVTPPPSKRSRLDSNSTQKPMLSAQLDDDDDDEHDPFPDASPTPRARPQPSSPSPIRSRKPELTSAQNQVVQSITIDSDSDDEVRPTQPAKRRSSINEVTDRTSAKFLEETTPPPVAEEEDEFAEYIRKAQENRARQQALQSPNTNESPKKEAISVMITSSIPNSGTLVAKFLFDKQLRVARNAWVAHQRKKGLQLNTDDIILTWRRTKIYNTSTLNGLGIRPCGNGRVEADGLGSAGFSNNRSVVHIEAWTPELFQEMEQKEELQRRRDAGELSDEEEPQQEERERFIITLKARDIQPLECKVMPETTVDTLIAVFRKQRQIGPDKEVSLWWDGDRLEEHIEMEQAEIEEHDTIEVHVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.72
3 0.67
4 0.63
5 0.61
6 0.67
7 0.61
8 0.56
9 0.52
10 0.49
11 0.46
12 0.41
13 0.37
14 0.28
15 0.25
16 0.2
17 0.14
18 0.14
19 0.14
20 0.2
21 0.23
22 0.24
23 0.29
24 0.32
25 0.34
26 0.4
27 0.46
28 0.47
29 0.47
30 0.46
31 0.43
32 0.43
33 0.41
34 0.33
35 0.29
36 0.29
37 0.3
38 0.34
39 0.39
40 0.44
41 0.51
42 0.6
43 0.66
44 0.68
45 0.71
46 0.76
47 0.79
48 0.83
49 0.83
50 0.78
51 0.68
52 0.6
53 0.53
54 0.44
55 0.38
56 0.38
57 0.39
58 0.46
59 0.54
60 0.56
61 0.57
62 0.62
63 0.61
64 0.56
65 0.51
66 0.46
67 0.45
68 0.47
69 0.46
70 0.41
71 0.37
72 0.32
73 0.28
74 0.26
75 0.2
76 0.14
77 0.16
78 0.16
79 0.16
80 0.16
81 0.16
82 0.15
83 0.14
84 0.14
85 0.12
86 0.12
87 0.14
88 0.16
89 0.18
90 0.15
91 0.16
92 0.17
93 0.18
94 0.18
95 0.17
96 0.15
97 0.12
98 0.13
99 0.14
100 0.12
101 0.1
102 0.11
103 0.14
104 0.13
105 0.13
106 0.14
107 0.14
108 0.16
109 0.17
110 0.15
111 0.11
112 0.12
113 0.12
114 0.11
115 0.11
116 0.14
117 0.2
118 0.24
119 0.28
120 0.27
121 0.29
122 0.3
123 0.3
124 0.3
125 0.25
126 0.22
127 0.18
128 0.23
129 0.22
130 0.22
131 0.22
132 0.18
133 0.18
134 0.19
135 0.26
136 0.25
137 0.27
138 0.3
139 0.36
140 0.44
141 0.49
142 0.55
143 0.57
144 0.63
145 0.68
146 0.67
147 0.6
148 0.5
149 0.44
150 0.38
151 0.33
152 0.25
153 0.17
154 0.15
155 0.18
156 0.18
157 0.17
158 0.16
159 0.11
160 0.11
161 0.11
162 0.1
163 0.07
164 0.08
165 0.08
166 0.08
167 0.08
168 0.09
169 0.09
170 0.1
171 0.17
172 0.19
173 0.23
174 0.28
175 0.33
176 0.36
177 0.42
178 0.46
179 0.49
180 0.51
181 0.55
182 0.51
183 0.53
184 0.57
185 0.59
186 0.58
187 0.54
188 0.57
189 0.56
190 0.58
191 0.58
192 0.53
193 0.53
194 0.54
195 0.51
196 0.47
197 0.43
198 0.38
199 0.31
200 0.28
201 0.19
202 0.14
203 0.11
204 0.08
205 0.05
206 0.05
207 0.05
208 0.06
209 0.06
210 0.07
211 0.07
212 0.07
213 0.08
214 0.09
215 0.09
216 0.1
217 0.15
218 0.21
219 0.29
220 0.34
221 0.37
222 0.41
223 0.44
224 0.52
225 0.53
226 0.51
227 0.5
228 0.46
229 0.45
230 0.43
231 0.39
232 0.31
233 0.26
234 0.2
235 0.14
236 0.13
237 0.11
238 0.13
239 0.13
240 0.14
241 0.16
242 0.17
243 0.16
244 0.15
245 0.15
246 0.12
247 0.12
248 0.1
249 0.08
250 0.08
251 0.08
252 0.08
253 0.08
254 0.08
255 0.07
256 0.08
257 0.09
258 0.1
259 0.1
260 0.18
261 0.25
262 0.32
263 0.36
264 0.43
265 0.43
266 0.41
267 0.46
268 0.46
269 0.44
270 0.41
271 0.4
272 0.34
273 0.36
274 0.38
275 0.35
276 0.29
277 0.27
278 0.27
279 0.26
280 0.25
281 0.22
282 0.2
283 0.2
284 0.21
285 0.19
286 0.14
287 0.14
288 0.13
289 0.12
290 0.12
291 0.1
292 0.07
293 0.07
294 0.07
295 0.07
296 0.08
297 0.08
298 0.1
299 0.09
300 0.1
301 0.1
302 0.11
303 0.17
304 0.17
305 0.18
306 0.2
307 0.26
308 0.27
309 0.3
310 0.3
311 0.26
312 0.31
313 0.3
314 0.3
315 0.33
316 0.38
317 0.42
318 0.47
319 0.46
320 0.43
321 0.51
322 0.55
323 0.5
324 0.51
325 0.48
326 0.47
327 0.45
328 0.43
329 0.33
330 0.26
331 0.24
332 0.2
333 0.16
334 0.15
335 0.16
336 0.17
337 0.19
338 0.23
339 0.29
340 0.33
341 0.41
342 0.41
343 0.41
344 0.42
345 0.4
346 0.38
347 0.29
348 0.24
349 0.16
350 0.13
351 0.12
352 0.12
353 0.12
354 0.14
355 0.14
356 0.15
357 0.15
358 0.18
359 0.17
360 0.16
361 0.17
362 0.14
363 0.13
364 0.1
365 0.09
366 0.05
367 0.05
368 0.06
369 0.06
370 0.08
371 0.09
372 0.1
373 0.12
374 0.13
375 0.14
376 0.15
377 0.15
378 0.14
379 0.15
380 0.17
381 0.15
382 0.14
383 0.12
384 0.12
385 0.11
386 0.11
387 0.18
388 0.17
389 0.19
390 0.2
391 0.21
392 0.24
393 0.32
394 0.37
395 0.34
396 0.38
397 0.38
398 0.39
399 0.41
400 0.38
401 0.33
402 0.35
403 0.31
404 0.3
405 0.29
406 0.27
407 0.25
408 0.24
409 0.23
410 0.16
411 0.18
412 0.2
413 0.19
414 0.22
415 0.23
416 0.22
417 0.21
418 0.23
419 0.25
420 0.23
421 0.29
422 0.28
423 0.31
424 0.31
425 0.36
426 0.36
427 0.34
428 0.39
429 0.38
430 0.41
431 0.37
432 0.38
433 0.35
434 0.34
435 0.3
436 0.25
437 0.23
438 0.2
439 0.2
440 0.19
441 0.17
442 0.15
443 0.17
444 0.16
445 0.14
446 0.17
447 0.22
448 0.3
449 0.33
450 0.36
451 0.43
452 0.51
453 0.56
454 0.59
455 0.59
456 0.53
457 0.52
458 0.49
459 0.43
460 0.37
461 0.32
462 0.24
463 0.22
464 0.19
465 0.2
466 0.2
467 0.2
468 0.2
469 0.19
470 0.2
471 0.18
472 0.19
473 0.16
474 0.15
475 0.14
476 0.11
477 0.11
478 0.1
479 0.1
480 0.1
481 0.1
482 0.1
483 0.08