Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395M4H3

Protein Details
Accession A0A395M4H3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
189-221KRFPKIMPAKPTKTPKQRDRVQKPQSTPRPIRTHydrophilic
NLS Segment(s)
PositionSequence
183-212ARKAQGKRFPKIMPAKPTKTPKQRDRVQKP
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MAANSPHTAQTGSAMGPPMHPASMDSKTPNLMSPPDQPHDTFDFRKFYGPRTIASSKVESEKHPMPMSPPISPYSKLVSSTAEVPTGSSNAIKDPLLYPVDESPSSPIQEPLFNTTESEQNHNSIIEDHIRARAQSPVTFARVSPPNHEEYNLVLCFKSQVMKNYTANPRNWLRQERRYLEEARKAQGKRFPKIMPAKPTKTPKQRDRVQKPQSTPRPIRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.19
5 0.18
6 0.16
7 0.15
8 0.15
9 0.18
10 0.21
11 0.24
12 0.24
13 0.24
14 0.26
15 0.27
16 0.27
17 0.24
18 0.23
19 0.24
20 0.3
21 0.34
22 0.36
23 0.37
24 0.36
25 0.38
26 0.41
27 0.42
28 0.38
29 0.36
30 0.36
31 0.35
32 0.41
33 0.38
34 0.36
35 0.4
36 0.38
37 0.35
38 0.39
39 0.4
40 0.36
41 0.38
42 0.37
43 0.29
44 0.33
45 0.33
46 0.27
47 0.31
48 0.32
49 0.33
50 0.31
51 0.29
52 0.27
53 0.33
54 0.34
55 0.29
56 0.27
57 0.25
58 0.27
59 0.28
60 0.27
61 0.23
62 0.22
63 0.21
64 0.2
65 0.2
66 0.18
67 0.2
68 0.18
69 0.15
70 0.13
71 0.12
72 0.12
73 0.11
74 0.1
75 0.08
76 0.07
77 0.07
78 0.09
79 0.08
80 0.08
81 0.08
82 0.11
83 0.11
84 0.11
85 0.11
86 0.11
87 0.14
88 0.13
89 0.13
90 0.12
91 0.13
92 0.14
93 0.13
94 0.14
95 0.12
96 0.14
97 0.14
98 0.16
99 0.16
100 0.15
101 0.15
102 0.14
103 0.18
104 0.17
105 0.2
106 0.17
107 0.16
108 0.17
109 0.16
110 0.15
111 0.12
112 0.12
113 0.11
114 0.11
115 0.11
116 0.13
117 0.13
118 0.13
119 0.13
120 0.16
121 0.16
122 0.15
123 0.19
124 0.18
125 0.21
126 0.21
127 0.2
128 0.22
129 0.26
130 0.27
131 0.28
132 0.28
133 0.29
134 0.3
135 0.31
136 0.25
137 0.22
138 0.26
139 0.22
140 0.19
141 0.15
142 0.15
143 0.15
144 0.15
145 0.17
146 0.14
147 0.2
148 0.24
149 0.3
150 0.32
151 0.39
152 0.48
153 0.5
154 0.49
155 0.49
156 0.5
157 0.52
158 0.56
159 0.58
160 0.57
161 0.59
162 0.68
163 0.67
164 0.66
165 0.64
166 0.63
167 0.61
168 0.63
169 0.57
170 0.52
171 0.55
172 0.51
173 0.52
174 0.54
175 0.54
176 0.5
177 0.54
178 0.5
179 0.53
180 0.61
181 0.64
182 0.66
183 0.68
184 0.68
185 0.7
186 0.78
187 0.78
188 0.79
189 0.81
190 0.81
191 0.82
192 0.85
193 0.87
194 0.88
195 0.89
196 0.88
197 0.87
198 0.85
199 0.86
200 0.87
201 0.86