Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395MN53

Protein Details
Accession A0A395MN53    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
137-166KDTSEKESVKDRKPKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
107-115GGRKRKVGK
130-158EKEDKKKKDTSEKESVKDRKPKKKAKKIK
Subcellular Location(s) nucl 15, cyto_nucl 12.333, mito_nucl 9.333, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPTPKINSKNLSYDNSAPPFLAALRAQAAGATGPDPLLAAQRRSAKKRSSSEEAEDVPLVVDEDGNVVRLEVDKDGVVKDTGDYDLEPATTKDEPVKESESKAAIGGRKRKVGKVVGSDADEAKAQGDEKEDKKKKDTSEKESVKDRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.51
4 0.46
5 0.38
6 0.32
7 0.28
8 0.23
9 0.21
10 0.13
11 0.12
12 0.13
13 0.13
14 0.13
15 0.12
16 0.12
17 0.09
18 0.09
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.11
26 0.13
27 0.14
28 0.19
29 0.27
30 0.34
31 0.39
32 0.46
33 0.47
34 0.54
35 0.6
36 0.62
37 0.61
38 0.59
39 0.58
40 0.56
41 0.51
42 0.43
43 0.36
44 0.28
45 0.21
46 0.16
47 0.12
48 0.07
49 0.05
50 0.03
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.08
78 0.08
79 0.08
80 0.11
81 0.12
82 0.13
83 0.15
84 0.2
85 0.19
86 0.2
87 0.22
88 0.2
89 0.19
90 0.19
91 0.19
92 0.18
93 0.23
94 0.3
95 0.31
96 0.38
97 0.39
98 0.41
99 0.44
100 0.46
101 0.46
102 0.44
103 0.45
104 0.4
105 0.4
106 0.39
107 0.33
108 0.28
109 0.23
110 0.16
111 0.12
112 0.1
113 0.09
114 0.08
115 0.12
116 0.17
117 0.22
118 0.33
119 0.39
120 0.42
121 0.47
122 0.53
123 0.57
124 0.62
125 0.67
126 0.64
127 0.69
128 0.72
129 0.72
130 0.76
131 0.76
132 0.74
133 0.75
134 0.76
135 0.76
136 0.8
137 0.86
138 0.87
139 0.9
140 0.92
141 0.93
142 0.95
143 0.94
144 0.94
145 0.92
146 0.9