Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MJU5

Protein Details
Accession A0A395MJU5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-69DENGRRMRWKRKDTNPKVEDBasic
NLS Segment(s)
Subcellular Location(s) E.R. 7, mito 6, extr 5, golg 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0016757  F:glycosyltransferase activity  
Amino Acid Sequences MPPLLHPKSRMTSSLFATTVAACFIVVTIPHMLPCPVPRARFADGDIMVDENGRRMRWKRKDTNPKVEDGIVQFNDVSSEEAESAQERAKRECPLPKPGGMLGEWLGFHKNDNETDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.32
4 0.3
5 0.27
6 0.21
7 0.17
8 0.13
9 0.07
10 0.06
11 0.06
12 0.05
13 0.05
14 0.07
15 0.08
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.12
22 0.17
23 0.18
24 0.19
25 0.22
26 0.26
27 0.29
28 0.28
29 0.28
30 0.28
31 0.25
32 0.24
33 0.22
34 0.17
35 0.14
36 0.13
37 0.11
38 0.08
39 0.09
40 0.08
41 0.11
42 0.15
43 0.26
44 0.35
45 0.45
46 0.52
47 0.61
48 0.73
49 0.79
50 0.85
51 0.77
52 0.7
53 0.62
54 0.53
55 0.44
56 0.35
57 0.3
58 0.19
59 0.18
60 0.15
61 0.13
62 0.13
63 0.12
64 0.11
65 0.06
66 0.07
67 0.07
68 0.07
69 0.08
70 0.08
71 0.09
72 0.11
73 0.14
74 0.15
75 0.19
76 0.23
77 0.26
78 0.31
79 0.39
80 0.41
81 0.47
82 0.5
83 0.48
84 0.48
85 0.45
86 0.42
87 0.33
88 0.31
89 0.22
90 0.2
91 0.18
92 0.16
93 0.17
94 0.14
95 0.16
96 0.18
97 0.2