Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395MID7

Protein Details
Accession A0A395MID7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
189-208LIAWLVLRRRNKNNTKPAESHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR001002  Chitin-bd_1  
IPR036861  Endochitinase-like_sf  
IPR004913  Herpes_gJ  
Gene Ontology GO:0016020  C:membrane  
GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF03229  Alpha_GJ  
PF00187  Chitin_bind_1  
PROSITE View protein in PROSITE  
PS50941  CHIT_BIND_I_2  
CDD cd11618  ChtBD1_1  
cd12087  TM_EGFR-like  
Amino Acid Sequences MELSLLYFLCLFSSALASRFGFEFSNSLILPRSNNPTSKDGNCGSNSDTNATCLTSTFGNCCSEKGFCGKTSAYCAEGCQEDFGTCSATDGQLGAHLETVAPQKGTAVIMKPTVVMVTLSTTTAADETSTLAASSTDDDASSADSTSTSEPTSATEGQSDSSSSDSLSTGAKAGIAIGAVIGGLGAIGLIAWLVLRRRNKNNTKPAESVAESNEVKPADELRYELHGETRAELPAYEVQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.16
4 0.16
5 0.16
6 0.16
7 0.17
8 0.14
9 0.14
10 0.15
11 0.13
12 0.17
13 0.15
14 0.15
15 0.16
16 0.16
17 0.18
18 0.21
19 0.27
20 0.28
21 0.32
22 0.36
23 0.39
24 0.44
25 0.43
26 0.45
27 0.4
28 0.41
29 0.38
30 0.36
31 0.34
32 0.33
33 0.32
34 0.29
35 0.27
36 0.23
37 0.22
38 0.21
39 0.17
40 0.12
41 0.13
42 0.11
43 0.12
44 0.12
45 0.13
46 0.17
47 0.17
48 0.17
49 0.18
50 0.17
51 0.18
52 0.22
53 0.22
54 0.19
55 0.23
56 0.23
57 0.22
58 0.27
59 0.27
60 0.23
61 0.21
62 0.2
63 0.18
64 0.19
65 0.17
66 0.13
67 0.12
68 0.1
69 0.1
70 0.1
71 0.1
72 0.08
73 0.09
74 0.08
75 0.08
76 0.08
77 0.07
78 0.07
79 0.07
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.08
86 0.1
87 0.08
88 0.08
89 0.08
90 0.07
91 0.08
92 0.09
93 0.08
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.09
100 0.08
101 0.07
102 0.05
103 0.04
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.06
127 0.07
128 0.07
129 0.06
130 0.05
131 0.05
132 0.07
133 0.07
134 0.08
135 0.07
136 0.07
137 0.07
138 0.09
139 0.13
140 0.12
141 0.12
142 0.12
143 0.12
144 0.13
145 0.13
146 0.12
147 0.09
148 0.09
149 0.09
150 0.08
151 0.08
152 0.07
153 0.08
154 0.08
155 0.08
156 0.07
157 0.07
158 0.07
159 0.06
160 0.06
161 0.05
162 0.05
163 0.04
164 0.03
165 0.03
166 0.03
167 0.02
168 0.02
169 0.02
170 0.01
171 0.01
172 0.01
173 0.01
174 0.01
175 0.01
176 0.01
177 0.01
178 0.02
179 0.04
180 0.06
181 0.12
182 0.2
183 0.27
184 0.37
185 0.48
186 0.58
187 0.67
188 0.76
189 0.8
190 0.8
191 0.76
192 0.7
193 0.66
194 0.58
195 0.5
196 0.42
197 0.39
198 0.33
199 0.3
200 0.31
201 0.24
202 0.23
203 0.21
204 0.21
205 0.17
206 0.18
207 0.19
208 0.18
209 0.22
210 0.23
211 0.23
212 0.23
213 0.24
214 0.24
215 0.25
216 0.24
217 0.22
218 0.2
219 0.2
220 0.2