Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395MES2

Protein Details
Accession A0A395MES2   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-71IAKPRPKTSDTKPCKNKTKKNDAAKAAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 4, pero 3
Family & Domain DBs
Amino Acid Sequences MPTEEQLRQMQEMRGDQEPVMLQTWLYELKDITSSTDVWSYERAIAKPRPKTSDTKPCKNKTKKNDAAKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.25
4 0.24
5 0.22
6 0.19
7 0.17
8 0.13
9 0.11
10 0.09
11 0.11
12 0.1
13 0.09
14 0.08
15 0.07
16 0.08
17 0.1
18 0.1
19 0.1
20 0.1
21 0.1
22 0.1
23 0.12
24 0.12
25 0.11
26 0.12
27 0.11
28 0.13
29 0.15
30 0.15
31 0.19
32 0.26
33 0.33
34 0.4
35 0.44
36 0.46
37 0.48
38 0.54
39 0.58
40 0.62
41 0.64
42 0.67
43 0.72
44 0.75
45 0.83
46 0.87
47 0.88
48 0.87
49 0.9
50 0.89
51 0.9