Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2QUH2

Protein Details
Accession A2QUH2   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
778-818YIEYNKSRNKQLKDKVGHHPLFRKLERERLKRKKELEDFMRBasic
NLS Segment(s)
PositionSequence
791-811DKVGHHPLFRKLERERLKRKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032438  ERCC3_RAD25_C  
IPR006935  Helicase/UvrB_N  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR001161  XPB/Ssl2  
IPR032830  XPB/Ssl2_N  
Gene Ontology GO:0005829  C:cytosol  
GO:0000112  C:nucleotide-excision repair factor 3 complex  
GO:0000439  C:transcription factor TFIIH core complex  
GO:0005675  C:transcription factor TFIIH holo complex  
GO:0097550  C:transcription preinitiation complex  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003677  F:DNA binding  
GO:0003678  F:DNA helicase activity  
GO:0015616  F:DNA translocase activity  
GO:0006289  P:nucleotide-excision repair  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
GO:0000019  P:regulation of mitotic recombination  
GO:0001111  P:RNA polymerase II promoter clearance  
GO:0001113  P:transcription open complex formation at RNA polymerase II promoter  
KEGG ang:ANI_1_704084  -  
Pfam View protein in Pfam  
PF16203  ERCC3_RAD25_C  
PF13625  Helicase_C_3  
PF04851  ResIII  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
CDD cd18029  DEXHc_XPB  
cd18789  SF2_C_XPB  
Amino Acid Sequences MPIKRKATDSGRSSRASKRPTPVPDIGSSDEYSDYEEEVKDDNLKGVLEKFSLESFSNKKSAAVQRQDPDFGYKDFSSLSLKPDHANRPLWIDPLKGTITLESFSPLAPQAQDFLTTIAEPLSRPTHLHEYRLTGNSLYAAVSVGLLPQDIINFLDRLSKTPLPDTIKSFILDFTKSYGKIKVVLKHNRFFVESTDPAMLQMLLQDEVIGSQRLKGTEGIIQQAAPKMGGLVIPGTKDAAGVRQASEQKPAEDGAGEARKEDDILLAIRDDDDDEEEVQVHSFEIPNEAVEPVKARCQAMGCPALEEYDFRNDEINPTLDIDLKPAARIRSYQEKSLSKMFGNGRAKSGIIVLPCGAGKTLVGITAGCTIKKGTIVLCTSSMSVVQWRNEFLRWSNIDPGDIAVFTSDNKEKFRRSTGIIVSTYSMVSQTRARSHDAQKMMDWIQSREWGLMILDEVHVVPASMFRKVTSAIACQSKLGLTATLLREDDKIKDLNFLIGPKLYEANWMELAEQGHIAKVQCAEVWCPMTTEFYSEYMREKSRKAALLYIMNPRKFQACQFLIDYHEKRGDKVIVFSDNVYALQRYALKLNKAYIYGGTPQNERMRILENFQHNEQVNTIFLSKIGDTSLDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTDEMFYSSKRQAFLVDQGYAFKVITHLQGIENLEGLAYATPSERRELLQEVMLQNETSAEVEHVTDDLFSGRSGGQRKGAVKRSAATLSGLAGGEDMAYIEYNKSRNKQLKDKVGHHPLFRKLERERLKRKKELEDFMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.64
4 0.64
5 0.64
6 0.66
7 0.69
8 0.73
9 0.7
10 0.66
11 0.62
12 0.6
13 0.56
14 0.5
15 0.43
16 0.37
17 0.31
18 0.26
19 0.25
20 0.2
21 0.17
22 0.15
23 0.15
24 0.15
25 0.16
26 0.17
27 0.17
28 0.17
29 0.18
30 0.17
31 0.17
32 0.18
33 0.19
34 0.2
35 0.17
36 0.18
37 0.18
38 0.17
39 0.2
40 0.19
41 0.22
42 0.24
43 0.28
44 0.31
45 0.29
46 0.3
47 0.35
48 0.44
49 0.48
50 0.52
51 0.56
52 0.58
53 0.62
54 0.63
55 0.56
56 0.52
57 0.44
58 0.37
59 0.35
60 0.28
61 0.25
62 0.23
63 0.23
64 0.24
65 0.22
66 0.25
67 0.24
68 0.26
69 0.29
70 0.36
71 0.41
72 0.42
73 0.45
74 0.42
75 0.44
76 0.45
77 0.46
78 0.4
79 0.35
80 0.3
81 0.3
82 0.29
83 0.23
84 0.22
85 0.19
86 0.19
87 0.17
88 0.16
89 0.13
90 0.12
91 0.12
92 0.13
93 0.11
94 0.12
95 0.12
96 0.12
97 0.12
98 0.13
99 0.14
100 0.13
101 0.13
102 0.12
103 0.11
104 0.11
105 0.1
106 0.11
107 0.09
108 0.13
109 0.15
110 0.15
111 0.16
112 0.21
113 0.31
114 0.32
115 0.36
116 0.35
117 0.38
118 0.43
119 0.45
120 0.4
121 0.3
122 0.28
123 0.25
124 0.22
125 0.17
126 0.11
127 0.08
128 0.07
129 0.07
130 0.06
131 0.06
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.07
139 0.08
140 0.08
141 0.08
142 0.15
143 0.15
144 0.18
145 0.25
146 0.27
147 0.27
148 0.29
149 0.36
150 0.36
151 0.39
152 0.41
153 0.37
154 0.36
155 0.35
156 0.33
157 0.28
158 0.24
159 0.22
160 0.18
161 0.18
162 0.21
163 0.21
164 0.23
165 0.24
166 0.22
167 0.28
168 0.33
169 0.37
170 0.43
171 0.52
172 0.57
173 0.59
174 0.62
175 0.57
176 0.53
177 0.47
178 0.41
179 0.38
180 0.31
181 0.29
182 0.26
183 0.23
184 0.22
185 0.21
186 0.17
187 0.09
188 0.1
189 0.08
190 0.07
191 0.07
192 0.07
193 0.06
194 0.07
195 0.08
196 0.08
197 0.07
198 0.09
199 0.11
200 0.12
201 0.13
202 0.14
203 0.14
204 0.17
205 0.19
206 0.19
207 0.18
208 0.17
209 0.18
210 0.19
211 0.18
212 0.13
213 0.11
214 0.08
215 0.08
216 0.08
217 0.07
218 0.07
219 0.08
220 0.08
221 0.08
222 0.09
223 0.08
224 0.08
225 0.08
226 0.09
227 0.11
228 0.11
229 0.12
230 0.17
231 0.22
232 0.23
233 0.29
234 0.28
235 0.26
236 0.26
237 0.25
238 0.2
239 0.16
240 0.15
241 0.15
242 0.18
243 0.17
244 0.16
245 0.16
246 0.16
247 0.16
248 0.16
249 0.1
250 0.07
251 0.08
252 0.08
253 0.07
254 0.07
255 0.07
256 0.07
257 0.07
258 0.06
259 0.07
260 0.07
261 0.08
262 0.08
263 0.08
264 0.08
265 0.08
266 0.07
267 0.06
268 0.06
269 0.06
270 0.06
271 0.08
272 0.08
273 0.08
274 0.08
275 0.09
276 0.08
277 0.08
278 0.1
279 0.08
280 0.13
281 0.14
282 0.14
283 0.15
284 0.16
285 0.18
286 0.21
287 0.25
288 0.2
289 0.19
290 0.19
291 0.19
292 0.17
293 0.16
294 0.13
295 0.15
296 0.15
297 0.14
298 0.16
299 0.15
300 0.17
301 0.18
302 0.17
303 0.12
304 0.12
305 0.13
306 0.14
307 0.13
308 0.13
309 0.13
310 0.12
311 0.13
312 0.14
313 0.15
314 0.13
315 0.15
316 0.18
317 0.27
318 0.29
319 0.32
320 0.37
321 0.38
322 0.41
323 0.44
324 0.41
325 0.3
326 0.34
327 0.31
328 0.33
329 0.37
330 0.35
331 0.32
332 0.31
333 0.3
334 0.24
335 0.24
336 0.17
337 0.11
338 0.11
339 0.09
340 0.09
341 0.09
342 0.08
343 0.07
344 0.05
345 0.05
346 0.05
347 0.05
348 0.05
349 0.05
350 0.05
351 0.06
352 0.11
353 0.12
354 0.1
355 0.11
356 0.11
357 0.11
358 0.12
359 0.12
360 0.07
361 0.11
362 0.12
363 0.13
364 0.14
365 0.14
366 0.13
367 0.13
368 0.12
369 0.08
370 0.11
371 0.13
372 0.14
373 0.14
374 0.15
375 0.16
376 0.17
377 0.18
378 0.15
379 0.19
380 0.19
381 0.2
382 0.24
383 0.23
384 0.22
385 0.21
386 0.2
387 0.13
388 0.11
389 0.09
390 0.04
391 0.04
392 0.04
393 0.07
394 0.09
395 0.1
396 0.13
397 0.16
398 0.18
399 0.2
400 0.25
401 0.25
402 0.25
403 0.3
404 0.3
405 0.32
406 0.31
407 0.29
408 0.25
409 0.22
410 0.19
411 0.13
412 0.11
413 0.06
414 0.07
415 0.1
416 0.12
417 0.15
418 0.17
419 0.21
420 0.26
421 0.31
422 0.36
423 0.36
424 0.35
425 0.31
426 0.33
427 0.3
428 0.27
429 0.23
430 0.17
431 0.16
432 0.17
433 0.17
434 0.13
435 0.12
436 0.1
437 0.09
438 0.08
439 0.07
440 0.05
441 0.05
442 0.05
443 0.05
444 0.04
445 0.04
446 0.04
447 0.04
448 0.07
449 0.08
450 0.09
451 0.09
452 0.09
453 0.1
454 0.11
455 0.14
456 0.12
457 0.13
458 0.16
459 0.19
460 0.19
461 0.18
462 0.17
463 0.15
464 0.14
465 0.13
466 0.09
467 0.06
468 0.11
469 0.12
470 0.14
471 0.14
472 0.13
473 0.15
474 0.16
475 0.16
476 0.14
477 0.15
478 0.14
479 0.16
480 0.16
481 0.17
482 0.17
483 0.16
484 0.14
485 0.13
486 0.13
487 0.11
488 0.12
489 0.09
490 0.13
491 0.13
492 0.15
493 0.15
494 0.15
495 0.15
496 0.16
497 0.16
498 0.12
499 0.11
500 0.09
501 0.08
502 0.09
503 0.09
504 0.08
505 0.09
506 0.09
507 0.09
508 0.1
509 0.11
510 0.12
511 0.14
512 0.13
513 0.13
514 0.13
515 0.15
516 0.14
517 0.15
518 0.13
519 0.14
520 0.15
521 0.15
522 0.18
523 0.19
524 0.23
525 0.24
526 0.24
527 0.27
528 0.31
529 0.35
530 0.34
531 0.34
532 0.34
533 0.37
534 0.39
535 0.43
536 0.44
537 0.4
538 0.39
539 0.36
540 0.35
541 0.3
542 0.29
543 0.29
544 0.24
545 0.26
546 0.27
547 0.28
548 0.3
549 0.37
550 0.36
551 0.3
552 0.35
553 0.32
554 0.3
555 0.33
556 0.33
557 0.26
558 0.28
559 0.28
560 0.24
561 0.24
562 0.24
563 0.21
564 0.17
565 0.17
566 0.14
567 0.11
568 0.09
569 0.1
570 0.11
571 0.11
572 0.16
573 0.19
574 0.21
575 0.23
576 0.26
577 0.26
578 0.26
579 0.25
580 0.21
581 0.2
582 0.22
583 0.24
584 0.23
585 0.22
586 0.27
587 0.31
588 0.32
589 0.3
590 0.26
591 0.27
592 0.26
593 0.29
594 0.3
595 0.31
596 0.34
597 0.34
598 0.38
599 0.33
600 0.33
601 0.3
602 0.25
603 0.19
604 0.17
605 0.17
606 0.1
607 0.1
608 0.11
609 0.1
610 0.09
611 0.09
612 0.08
613 0.08
614 0.11
615 0.12
616 0.11
617 0.11
618 0.1
619 0.1
620 0.11
621 0.1
622 0.07
623 0.06
624 0.06
625 0.07
626 0.07
627 0.12
628 0.14
629 0.17
630 0.18
631 0.24
632 0.26
633 0.29
634 0.38
635 0.37
636 0.41
637 0.45
638 0.52
639 0.55
640 0.58
641 0.55
642 0.52
643 0.55
644 0.56
645 0.58
646 0.6
647 0.59
648 0.6
649 0.68
650 0.69
651 0.67
652 0.67
653 0.63
654 0.57
655 0.52
656 0.48
657 0.38
658 0.31
659 0.27
660 0.21
661 0.15
662 0.13
663 0.12
664 0.11
665 0.12
666 0.14
667 0.15
668 0.14
669 0.16
670 0.17
671 0.18
672 0.21
673 0.25
674 0.26
675 0.25
676 0.24
677 0.25
678 0.26
679 0.31
680 0.32
681 0.29
682 0.27
683 0.27
684 0.28
685 0.26
686 0.22
687 0.15
688 0.12
689 0.11
690 0.13
691 0.13
692 0.13
693 0.13
694 0.18
695 0.2
696 0.18
697 0.17
698 0.15
699 0.13
700 0.11
701 0.11
702 0.07
703 0.05
704 0.05
705 0.07
706 0.1
707 0.11
708 0.14
709 0.15
710 0.16
711 0.19
712 0.23
713 0.24
714 0.24
715 0.28
716 0.26
717 0.28
718 0.28
719 0.24
720 0.2
721 0.18
722 0.15
723 0.1
724 0.1
725 0.08
726 0.08
727 0.08
728 0.09
729 0.08
730 0.08
731 0.07
732 0.07
733 0.08
734 0.07
735 0.07
736 0.08
737 0.1
738 0.15
739 0.19
740 0.22
741 0.26
742 0.32
743 0.38
744 0.46
745 0.54
746 0.54
747 0.53
748 0.53
749 0.53
750 0.5
751 0.45
752 0.37
753 0.29
754 0.24
755 0.23
756 0.21
757 0.15
758 0.12
759 0.11
760 0.08
761 0.08
762 0.07
763 0.05
764 0.05
765 0.06
766 0.08
767 0.12
768 0.17
769 0.24
770 0.28
771 0.38
772 0.46
773 0.54
774 0.63
775 0.69
776 0.75
777 0.78
778 0.81
779 0.82
780 0.84
781 0.81
782 0.78
783 0.75
784 0.74
785 0.74
786 0.7
787 0.68
788 0.62
789 0.67
790 0.7
791 0.73
792 0.75
793 0.77
794 0.84
795 0.85
796 0.87
797 0.88
798 0.86