Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MTQ2

Protein Details
Accession A0A395MTQ2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-54ENKYGPARIVRRRRSRAGRRGPPGSHBasic
NLS Segment(s)
PositionSequence
33-51GPARIVRRRRSRAGRRGPP
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MTACTTYRDASSYAPVFPSPLNPTNHRPENKYGPARIVRRRRSRAGRRGPPGSHTLTQRFLRVKAADAWRGHVLSAQVTQYEHAEAAAMASVKGYKSRNCCPSMLGLKNLGLNFSLSDAHRIASSIRLPDLLNLKTRRMLLAMGLVGLLPALKVRDMLRAAESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.21
5 0.24
6 0.23
7 0.28
8 0.32
9 0.36
10 0.42
11 0.5
12 0.58
13 0.57
14 0.55
15 0.56
16 0.6
17 0.65
18 0.65
19 0.57
20 0.56
21 0.6
22 0.63
23 0.65
24 0.66
25 0.67
26 0.71
27 0.76
28 0.79
29 0.81
30 0.85
31 0.86
32 0.86
33 0.86
34 0.83
35 0.83
36 0.75
37 0.67
38 0.61
39 0.56
40 0.49
41 0.43
42 0.39
43 0.38
44 0.37
45 0.39
46 0.36
47 0.31
48 0.32
49 0.28
50 0.27
51 0.28
52 0.31
53 0.32
54 0.3
55 0.32
56 0.28
57 0.28
58 0.25
59 0.2
60 0.16
61 0.11
62 0.12
63 0.1
64 0.08
65 0.08
66 0.09
67 0.08
68 0.08
69 0.07
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.08
81 0.1
82 0.14
83 0.19
84 0.27
85 0.34
86 0.36
87 0.36
88 0.34
89 0.39
90 0.43
91 0.4
92 0.35
93 0.29
94 0.28
95 0.3
96 0.29
97 0.22
98 0.15
99 0.12
100 0.11
101 0.1
102 0.11
103 0.09
104 0.12
105 0.12
106 0.12
107 0.11
108 0.12
109 0.11
110 0.14
111 0.16
112 0.15
113 0.15
114 0.16
115 0.16
116 0.19
117 0.24
118 0.22
119 0.27
120 0.28
121 0.3
122 0.32
123 0.33
124 0.3
125 0.26
126 0.24
127 0.18
128 0.2
129 0.18
130 0.14
131 0.13
132 0.12
133 0.1
134 0.09
135 0.08
136 0.03
137 0.04
138 0.05
139 0.06
140 0.08
141 0.09
142 0.17
143 0.18
144 0.21