Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395M4E7

Protein Details
Accession A0A395M4E7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-73RTCYQCRDKCRDCPKFPNKKLRQAAWHydrophilic
NLS Segment(s)
PositionSequence
124-129AARKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences AKRTPDGNDNFSGGACPPCSLEVALMGEDDELPDYPCHKDYGEHAEERTCYQCRDKCRDCPKFPNKKLRQAAWDLSYALRSCLHDDSPENVQALTAAKAVYREVHGQTVELEALRSAAKRAENAARKRKQEWRGAAAALAEIMPLANEKLSYIWQPNPPEDHPADVRELEGEFLMKRVAELETREEFYMAREEADRRSCDWELAVLKFKASYSPPPDDGYDSDVDSEWLLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.14
4 0.13
5 0.14
6 0.15
7 0.14
8 0.13
9 0.13
10 0.14
11 0.13
12 0.12
13 0.11
14 0.1
15 0.1
16 0.09
17 0.08
18 0.06
19 0.08
20 0.09
21 0.1
22 0.13
23 0.14
24 0.15
25 0.15
26 0.16
27 0.19
28 0.28
29 0.31
30 0.3
31 0.3
32 0.32
33 0.32
34 0.33
35 0.33
36 0.26
37 0.23
38 0.3
39 0.33
40 0.38
41 0.47
42 0.51
43 0.56
44 0.66
45 0.73
46 0.73
47 0.8
48 0.82
49 0.84
50 0.86
51 0.87
52 0.84
53 0.84
54 0.84
55 0.78
56 0.73
57 0.68
58 0.64
59 0.55
60 0.49
61 0.39
62 0.32
63 0.29
64 0.23
65 0.18
66 0.15
67 0.13
68 0.14
69 0.15
70 0.15
71 0.15
72 0.16
73 0.18
74 0.2
75 0.2
76 0.18
77 0.16
78 0.15
79 0.14
80 0.13
81 0.11
82 0.08
83 0.07
84 0.07
85 0.07
86 0.08
87 0.08
88 0.09
89 0.11
90 0.11
91 0.13
92 0.13
93 0.13
94 0.13
95 0.12
96 0.11
97 0.08
98 0.07
99 0.05
100 0.05
101 0.06
102 0.05
103 0.05
104 0.07
105 0.08
106 0.08
107 0.12
108 0.18
109 0.26
110 0.34
111 0.44
112 0.48
113 0.51
114 0.55
115 0.61
116 0.61
117 0.62
118 0.59
119 0.54
120 0.5
121 0.47
122 0.43
123 0.34
124 0.26
125 0.18
126 0.12
127 0.06
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.05
137 0.06
138 0.08
139 0.11
140 0.15
141 0.21
142 0.23
143 0.26
144 0.3
145 0.29
146 0.33
147 0.3
148 0.3
149 0.27
150 0.26
151 0.26
152 0.21
153 0.2
154 0.16
155 0.15
156 0.11
157 0.1
158 0.09
159 0.07
160 0.07
161 0.08
162 0.06
163 0.06
164 0.07
165 0.08
166 0.1
167 0.12
168 0.17
169 0.19
170 0.22
171 0.22
172 0.21
173 0.2
174 0.19
175 0.22
176 0.16
177 0.15
178 0.15
179 0.17
180 0.22
181 0.28
182 0.28
183 0.26
184 0.32
185 0.31
186 0.3
187 0.29
188 0.29
189 0.26
190 0.28
191 0.33
192 0.27
193 0.26
194 0.26
195 0.26
196 0.25
197 0.25
198 0.31
199 0.31
200 0.37
201 0.39
202 0.41
203 0.43
204 0.42
205 0.4
206 0.36
207 0.3
208 0.24
209 0.23
210 0.2
211 0.19
212 0.16