Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395N5R3

Protein Details
Accession A0A395N5R3   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-75DKDESKDGKKDKSKDKKDDTEKKDEDAcidic
NLS Segment(s)
PositionSequence
59-59K
61-61K
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, cyto 8, cyto_pero 5.333, mito 2
Family & Domain DBs
Amino Acid Sequences MTDSKHEDVEKTNGEEQTGEKHQIEQDAPDAKRTKTDGQTTLDDVVIRSDKDESKDGKKDKSKDKKDDTEKKDEDNVKSEKKVSNGEDAVQPAEEPDVPSNILEKGIIYFFIRGRVNLEDPESVDDIARSFIMLRPIAKDARLGDGPIADAGNTRLLALPKKTLPESGKEKYMVFVEKSHASYEEIKKEFLSADEYDTKSAGTRRTPPAKPVGEGVYAITSTGRESHLAYLTTLPEKLDEVQKELGIKEKGSFIISTKNPQFPGPQNAQLPEGPGFPKEIIDEFRSLRWLPSKPAHFDYPNAQILFIGESEGIEKAVEPQKKDEKDGKEEPEKILEHLEEDDVKRMKHLADDQSAAIYADLHVQAKDYPKLQTTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.31
4 0.32
5 0.32
6 0.31
7 0.26
8 0.29
9 0.3
10 0.34
11 0.34
12 0.29
13 0.31
14 0.34
15 0.34
16 0.38
17 0.4
18 0.35
19 0.39
20 0.42
21 0.44
22 0.44
23 0.52
24 0.5
25 0.51
26 0.54
27 0.52
28 0.48
29 0.41
30 0.33
31 0.26
32 0.24
33 0.21
34 0.18
35 0.16
36 0.19
37 0.21
38 0.24
39 0.31
40 0.32
41 0.38
42 0.47
43 0.51
44 0.57
45 0.62
46 0.67
47 0.71
48 0.77
49 0.8
50 0.81
51 0.86
52 0.87
53 0.89
54 0.91
55 0.87
56 0.87
57 0.79
58 0.73
59 0.72
60 0.69
61 0.61
62 0.58
63 0.57
64 0.52
65 0.52
66 0.52
67 0.46
68 0.43
69 0.46
70 0.42
71 0.43
72 0.39
73 0.38
74 0.36
75 0.34
76 0.31
77 0.24
78 0.21
79 0.13
80 0.13
81 0.11
82 0.1
83 0.1
84 0.1
85 0.11
86 0.11
87 0.12
88 0.11
89 0.11
90 0.09
91 0.08
92 0.08
93 0.08
94 0.09
95 0.08
96 0.1
97 0.1
98 0.16
99 0.17
100 0.15
101 0.18
102 0.2
103 0.22
104 0.21
105 0.23
106 0.18
107 0.18
108 0.2
109 0.18
110 0.15
111 0.13
112 0.12
113 0.1
114 0.1
115 0.09
116 0.06
117 0.06
118 0.07
119 0.11
120 0.12
121 0.13
122 0.14
123 0.18
124 0.19
125 0.18
126 0.19
127 0.16
128 0.19
129 0.18
130 0.16
131 0.14
132 0.13
133 0.13
134 0.11
135 0.1
136 0.05
137 0.05
138 0.06
139 0.07
140 0.06
141 0.07
142 0.08
143 0.09
144 0.12
145 0.13
146 0.15
147 0.15
148 0.18
149 0.18
150 0.22
151 0.22
152 0.26
153 0.32
154 0.31
155 0.33
156 0.32
157 0.32
158 0.28
159 0.28
160 0.24
161 0.18
162 0.17
163 0.16
164 0.17
165 0.18
166 0.17
167 0.16
168 0.16
169 0.21
170 0.24
171 0.28
172 0.27
173 0.26
174 0.25
175 0.25
176 0.23
177 0.18
178 0.17
179 0.1
180 0.13
181 0.16
182 0.17
183 0.17
184 0.17
185 0.16
186 0.14
187 0.16
188 0.15
189 0.15
190 0.2
191 0.28
192 0.36
193 0.37
194 0.39
195 0.45
196 0.44
197 0.41
198 0.37
199 0.32
200 0.25
201 0.24
202 0.21
203 0.13
204 0.11
205 0.1
206 0.08
207 0.06
208 0.05
209 0.06
210 0.07
211 0.07
212 0.08
213 0.1
214 0.12
215 0.13
216 0.13
217 0.13
218 0.14
219 0.14
220 0.14
221 0.11
222 0.1
223 0.1
224 0.11
225 0.16
226 0.15
227 0.17
228 0.18
229 0.19
230 0.2
231 0.19
232 0.23
233 0.19
234 0.18
235 0.16
236 0.17
237 0.17
238 0.17
239 0.17
240 0.12
241 0.19
242 0.2
243 0.27
244 0.29
245 0.32
246 0.32
247 0.33
248 0.37
249 0.34
250 0.4
251 0.37
252 0.39
253 0.37
254 0.38
255 0.39
256 0.34
257 0.31
258 0.25
259 0.22
260 0.17
261 0.15
262 0.16
263 0.14
264 0.14
265 0.13
266 0.14
267 0.15
268 0.17
269 0.2
270 0.19
271 0.2
272 0.23
273 0.22
274 0.23
275 0.25
276 0.25
277 0.28
278 0.35
279 0.4
280 0.42
281 0.46
282 0.49
283 0.45
284 0.45
285 0.44
286 0.44
287 0.43
288 0.38
289 0.33
290 0.27
291 0.26
292 0.25
293 0.19
294 0.13
295 0.07
296 0.07
297 0.08
298 0.08
299 0.08
300 0.06
301 0.06
302 0.12
303 0.19
304 0.22
305 0.24
306 0.31
307 0.41
308 0.43
309 0.5
310 0.52
311 0.52
312 0.57
313 0.63
314 0.63
315 0.63
316 0.63
317 0.59
318 0.58
319 0.52
320 0.44
321 0.41
322 0.33
323 0.26
324 0.24
325 0.24
326 0.21
327 0.21
328 0.28
329 0.26
330 0.26
331 0.26
332 0.26
333 0.25
334 0.27
335 0.33
336 0.34
337 0.37
338 0.39
339 0.38
340 0.37
341 0.37
342 0.3
343 0.23
344 0.15
345 0.1
346 0.12
347 0.14
348 0.14
349 0.13
350 0.14
351 0.18
352 0.23
353 0.28
354 0.26
355 0.28