Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QNS9

Protein Details
Accession A0A372QNS9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MASFKKRNLKLLKKKLFFPFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MASFKKRNLKLLKKKLFFPFFVFSCREISSDVNTGFPIFFPLLNYPDFQYGNWFILFSLYEISRTDKRISNLRMDQMEMDFWFLGDWMKPRELLRWILNFPITFVDRNPCVFFMYEYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.77
4 0.68
5 0.63
6 0.58
7 0.49
8 0.49
9 0.44
10 0.36
11 0.33
12 0.31
13 0.26
14 0.21
15 0.22
16 0.21
17 0.23
18 0.22
19 0.19
20 0.18
21 0.18
22 0.16
23 0.14
24 0.13
25 0.08
26 0.08
27 0.09
28 0.11
29 0.12
30 0.13
31 0.14
32 0.12
33 0.15
34 0.15
35 0.13
36 0.15
37 0.15
38 0.15
39 0.15
40 0.14
41 0.1
42 0.11
43 0.11
44 0.07
45 0.07
46 0.06
47 0.07
48 0.07
49 0.11
50 0.12
51 0.15
52 0.17
53 0.19
54 0.22
55 0.29
56 0.31
57 0.36
58 0.37
59 0.39
60 0.37
61 0.34
62 0.32
63 0.25
64 0.24
65 0.16
66 0.14
67 0.1
68 0.09
69 0.08
70 0.07
71 0.07
72 0.07
73 0.1
74 0.11
75 0.12
76 0.15
77 0.16
78 0.2
79 0.23
80 0.27
81 0.3
82 0.32
83 0.33
84 0.34
85 0.36
86 0.32
87 0.29
88 0.28
89 0.24
90 0.2
91 0.21
92 0.24
93 0.23
94 0.27
95 0.28
96 0.25
97 0.25
98 0.24