Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QUN5

Protein Details
Accession A0A372QUN5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-102ASRENTKKKRKLFDEEQLKLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 17, nucl 13, cyto 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008266  Tyr_kinase_AS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00109  PROTEIN_KINASE_TYR  
Amino Acid Sequences MQKEYIPKLVCYGYYEEGMSFVISLTIVGTMLSDQKIMEQQKSKAIKGLEAIHKYGILHNDIREENILINDNDDIYLIDFGMASRENTKKKRKLFDEEQLKLSQLLDGYIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.19
4 0.18
5 0.17
6 0.14
7 0.09
8 0.07
9 0.05
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.06
19 0.06
20 0.06
21 0.06
22 0.07
23 0.13
24 0.15
25 0.19
26 0.21
27 0.23
28 0.31
29 0.34
30 0.34
31 0.32
32 0.31
33 0.27
34 0.26
35 0.31
36 0.29
37 0.28
38 0.28
39 0.24
40 0.24
41 0.23
42 0.22
43 0.17
44 0.13
45 0.12
46 0.11
47 0.14
48 0.14
49 0.15
50 0.14
51 0.13
52 0.11
53 0.1
54 0.12
55 0.09
56 0.09
57 0.09
58 0.08
59 0.08
60 0.07
61 0.06
62 0.05
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.07
70 0.07
71 0.12
72 0.18
73 0.26
74 0.35
75 0.45
76 0.52
77 0.6
78 0.69
79 0.72
80 0.76
81 0.77
82 0.8
83 0.8
84 0.76
85 0.72
86 0.63
87 0.56
88 0.47
89 0.38
90 0.29
91 0.18