Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RBZ8

Protein Details
Accession A0A372RBZ8    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-67SITPHNKKLRSKKKNLINLTKKKHydrophilic
NLS Segment(s)
PositionSequence
51-59KKLRSKKKN
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
Amino Acid Sequences MADYKDFKVPYEFEYIPRIFSIESWWKMIEQHDNWIREIALIINSITPHNKKLRSKKKNLINLTKKKILIKIIIIDKYFNINEELRRALRVEIKVVIEQPAVPAYDHGEKEFDIIKLLDSTLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.3
4 0.28
5 0.26
6 0.18
7 0.17
8 0.23
9 0.24
10 0.25
11 0.26
12 0.27
13 0.26
14 0.28
15 0.3
16 0.31
17 0.24
18 0.31
19 0.35
20 0.36
21 0.36
22 0.36
23 0.33
24 0.24
25 0.23
26 0.15
27 0.09
28 0.08
29 0.08
30 0.08
31 0.08
32 0.09
33 0.12
34 0.12
35 0.16
36 0.21
37 0.28
38 0.35
39 0.45
40 0.56
41 0.63
42 0.71
43 0.75
44 0.79
45 0.81
46 0.81
47 0.81
48 0.8
49 0.8
50 0.76
51 0.73
52 0.65
53 0.58
54 0.53
55 0.45
56 0.37
57 0.3
58 0.29
59 0.29
60 0.3
61 0.28
62 0.26
63 0.23
64 0.24
65 0.22
66 0.17
67 0.15
68 0.14
69 0.15
70 0.17
71 0.2
72 0.17
73 0.18
74 0.19
75 0.18
76 0.23
77 0.23
78 0.23
79 0.22
80 0.24
81 0.24
82 0.24
83 0.23
84 0.18
85 0.16
86 0.15
87 0.14
88 0.12
89 0.11
90 0.11
91 0.13
92 0.19
93 0.2
94 0.2
95 0.2
96 0.19
97 0.21
98 0.23
99 0.19
100 0.16
101 0.15
102 0.16
103 0.15