Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QCL5

Protein Details
Accession A0A372QCL5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-72GGGLYDYKNKKHKKKKKHKNYARHFINKRNBasic
NLS Segment(s)
PositionSequence
50-63KNKKHKKKKKHKNY
Subcellular Location(s) mito 14, extr 5, cyto 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MRKHNLIVLTAVVIILCLTTLSNGVVIKSNLVKRKQDSPYTQGGGLYDYKNKKHKKKKKHKNYARHFINKRNEDDIDPDIGEVSVKQEEKAHLKKRQTPPVSVGHVDSSKTIPGKSGNPGNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.04
4 0.03
5 0.03
6 0.04
7 0.05
8 0.05
9 0.07
10 0.07
11 0.08
12 0.11
13 0.11
14 0.13
15 0.18
16 0.23
17 0.28
18 0.32
19 0.37
20 0.37
21 0.47
22 0.51
23 0.54
24 0.53
25 0.52
26 0.54
27 0.51
28 0.48
29 0.39
30 0.33
31 0.27
32 0.23
33 0.2
34 0.19
35 0.2
36 0.25
37 0.33
38 0.41
39 0.49
40 0.59
41 0.67
42 0.72
43 0.81
44 0.87
45 0.9
46 0.93
47 0.93
48 0.93
49 0.94
50 0.93
51 0.9
52 0.89
53 0.82
54 0.8
55 0.79
56 0.73
57 0.66
58 0.59
59 0.51
60 0.42
61 0.41
62 0.34
63 0.26
64 0.21
65 0.17
66 0.13
67 0.12
68 0.11
69 0.07
70 0.07
71 0.09
72 0.09
73 0.1
74 0.13
75 0.16
76 0.25
77 0.34
78 0.41
79 0.45
80 0.52
81 0.61
82 0.69
83 0.76
84 0.72
85 0.67
86 0.64
87 0.64
88 0.62
89 0.54
90 0.46
91 0.4
92 0.37
93 0.34
94 0.3
95 0.24
96 0.23
97 0.23
98 0.21
99 0.19
100 0.22
101 0.25
102 0.32