Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RNZ1

Protein Details
Accession A0A372RNZ1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
4-28NFQVRHARVLQKKKRQWSAREKLMVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences VRGNFQVRHARVLQKKKRQWSAREKLMVIAYYEQGHSKXSTADKYEIEPKQLREWLKNKDQLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.77
4 0.83
5 0.82
6 0.83
7 0.83
8 0.83
9 0.81
10 0.78
11 0.68
12 0.61
13 0.54
14 0.44
15 0.34
16 0.25
17 0.17
18 0.13
19 0.13
20 0.11
21 0.1
22 0.1
23 0.1
24 0.09
25 0.13
26 0.15
27 0.17
28 0.18
29 0.2
30 0.23
31 0.33
32 0.34
33 0.36
34 0.38
35 0.38
36 0.43
37 0.46
38 0.46
39 0.45
40 0.51
41 0.53
42 0.58