Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A2R4N5

Protein Details
Accession A2R4N5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-99ENDKKEKEVKYRVKKRRNMEWKVBasic
NLS Segment(s)
PositionSequence
83-93KEVKYRVKKRR
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MAQHIPSSKGILILSFPELVCSELFYLLYSRTLRESVAKQIPARAQHRTALSHIPHAYLPNIAGCHQPSCQVCLCGENDKKEKEVKYRVKKRRNMEWKVKEEPCSFYPWGKKENGSTVSPCTPYYVHSKRRCDLISWVDDGSIGLGIHTGNATRSTHLYLIYLGRSRRPIPSKPTVTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.14
5 0.14
6 0.15
7 0.13
8 0.13
9 0.11
10 0.1
11 0.11
12 0.1
13 0.1
14 0.1
15 0.14
16 0.14
17 0.14
18 0.15
19 0.16
20 0.16
21 0.2
22 0.22
23 0.27
24 0.33
25 0.36
26 0.34
27 0.39
28 0.42
29 0.44
30 0.45
31 0.42
32 0.38
33 0.38
34 0.4
35 0.37
36 0.36
37 0.36
38 0.33
39 0.34
40 0.32
41 0.29
42 0.27
43 0.26
44 0.23
45 0.16
46 0.16
47 0.11
48 0.11
49 0.11
50 0.12
51 0.12
52 0.13
53 0.13
54 0.17
55 0.16
56 0.19
57 0.19
58 0.18
59 0.17
60 0.18
61 0.19
62 0.22
63 0.24
64 0.27
65 0.3
66 0.3
67 0.32
68 0.34
69 0.35
70 0.35
71 0.42
72 0.46
73 0.53
74 0.63
75 0.71
76 0.76
77 0.81
78 0.8
79 0.81
80 0.81
81 0.79
82 0.79
83 0.78
84 0.75
85 0.75
86 0.71
87 0.66
88 0.57
89 0.53
90 0.43
91 0.4
92 0.35
93 0.31
94 0.35
95 0.32
96 0.34
97 0.32
98 0.33
99 0.29
100 0.35
101 0.35
102 0.31
103 0.3
104 0.3
105 0.31
106 0.3
107 0.28
108 0.23
109 0.19
110 0.19
111 0.27
112 0.32
113 0.39
114 0.46
115 0.52
116 0.52
117 0.59
118 0.58
119 0.51
120 0.5
121 0.48
122 0.43
123 0.38
124 0.36
125 0.29
126 0.28
127 0.25
128 0.18
129 0.11
130 0.07
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.06
137 0.06
138 0.09
139 0.1
140 0.12
141 0.14
142 0.17
143 0.18
144 0.18
145 0.18
146 0.17
147 0.19
148 0.22
149 0.25
150 0.23
151 0.27
152 0.32
153 0.33
154 0.41
155 0.45
156 0.48
157 0.52
158 0.61