Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RRN2

Protein Details
Accession A0A372RRN2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-88EDYMKRMRLLEKQKKKEEKSKLENKVBasic
NLS Segment(s)
PositionSequence
74-83KQKKKEEKSK
Subcellular Location(s) nucl 18, mito 4, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008698  NDUB7  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005758  C:mitochondrial intermembrane space  
GO:0070469  C:respirasome  
Pfam View protein in Pfam  
PF05676  NDUF_B7  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MTSDGPPEMIATQKEMAEAKLPLGYRDYCAHLLISLNKCRTETWYLPWKCEDEKHSWEKCQYEDYMKRMRLLEKQKKKEEKSKLENKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.17
4 0.17
5 0.16
6 0.14
7 0.15
8 0.15
9 0.14
10 0.17
11 0.17
12 0.16
13 0.18
14 0.21
15 0.19
16 0.19
17 0.19
18 0.16
19 0.17
20 0.2
21 0.23
22 0.24
23 0.25
24 0.25
25 0.26
26 0.25
27 0.28
28 0.28
29 0.25
30 0.25
31 0.34
32 0.34
33 0.35
34 0.36
35 0.34
36 0.28
37 0.31
38 0.29
39 0.25
40 0.32
41 0.39
42 0.4
43 0.41
44 0.44
45 0.42
46 0.4
47 0.37
48 0.32
49 0.33
50 0.35
51 0.38
52 0.43
53 0.42
54 0.44
55 0.43
56 0.45
57 0.45
58 0.51
59 0.56
60 0.59
61 0.67
62 0.74
63 0.82
64 0.86
65 0.87
66 0.87
67 0.86
68 0.86