Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QRF4

Protein Details
Accession A0A372QRF4   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-22KTNSNRSRRNHVSRSLRAPNGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 10, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF09011  HMG_box_2  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MKTNSNRSRRNHVSRSLRAPNGFSFYFKFIKNYLKNDYPNHSPQERMQIASEKWNSLSNTEKNEYIKYANDDRILKQNPDLTVVQASNVNEPGNNKSLVMIFSDLSSHPVASDLGLRTSEEYFDYDKYYKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.8
4 0.75
5 0.67
6 0.63
7 0.55
8 0.51
9 0.43
10 0.36
11 0.3
12 0.29
13 0.29
14 0.27
15 0.27
16 0.24
17 0.33
18 0.37
19 0.4
20 0.42
21 0.46
22 0.5
23 0.52
24 0.54
25 0.51
26 0.5
27 0.5
28 0.44
29 0.39
30 0.36
31 0.42
32 0.37
33 0.32
34 0.29
35 0.29
36 0.28
37 0.34
38 0.33
39 0.24
40 0.23
41 0.26
42 0.25
43 0.22
44 0.27
45 0.22
46 0.26
47 0.27
48 0.28
49 0.25
50 0.26
51 0.25
52 0.2
53 0.18
54 0.17
55 0.19
56 0.2
57 0.22
58 0.23
59 0.23
60 0.3
61 0.31
62 0.27
63 0.26
64 0.28
65 0.24
66 0.27
67 0.25
68 0.18
69 0.18
70 0.18
71 0.16
72 0.15
73 0.15
74 0.13
75 0.14
76 0.13
77 0.11
78 0.13
79 0.16
80 0.16
81 0.16
82 0.15
83 0.14
84 0.15
85 0.15
86 0.15
87 0.13
88 0.1
89 0.1
90 0.12
91 0.11
92 0.13
93 0.13
94 0.11
95 0.09
96 0.1
97 0.1
98 0.09
99 0.14
100 0.12
101 0.13
102 0.14
103 0.15
104 0.15
105 0.16
106 0.16
107 0.13
108 0.15
109 0.16
110 0.16
111 0.21