Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R6I4

Protein Details
Accession A0A372R6I4   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-107DVAFTPKKRIQKLSKNQISTFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 12.166, nucl 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012296  Nuclease_put_TT1808  
Amino Acid Sequences MSSDVKASNTKKLYTQFTKTPAWWLLTTNLSTTSSWKANPRASNKEAVVVKIVSLFKDWNVTIRQKGIVTTSQGGFQVSKDTIVAPDVAFTPKKRIQKLSKNQISTFEAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.5
4 0.52
5 0.55
6 0.5
7 0.5
8 0.44
9 0.4
10 0.34
11 0.3
12 0.28
13 0.27
14 0.27
15 0.22
16 0.2
17 0.18
18 0.18
19 0.18
20 0.19
21 0.18
22 0.19
23 0.24
24 0.28
25 0.32
26 0.39
27 0.43
28 0.47
29 0.48
30 0.51
31 0.45
32 0.46
33 0.4
34 0.34
35 0.29
36 0.21
37 0.19
38 0.17
39 0.17
40 0.11
41 0.11
42 0.11
43 0.09
44 0.12
45 0.12
46 0.11
47 0.14
48 0.17
49 0.17
50 0.18
51 0.2
52 0.17
53 0.18
54 0.17
55 0.16
56 0.17
57 0.18
58 0.17
59 0.17
60 0.17
61 0.17
62 0.15
63 0.13
64 0.14
65 0.11
66 0.11
67 0.1
68 0.11
69 0.1
70 0.11
71 0.12
72 0.07
73 0.08
74 0.09
75 0.12
76 0.14
77 0.15
78 0.23
79 0.28
80 0.36
81 0.41
82 0.49
83 0.57
84 0.66
85 0.76
86 0.79
87 0.82
88 0.8
89 0.76
90 0.73