Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RUF4

Protein Details
Accession A0A372RUF4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-39LEIARRKDAKCKYFKKKNGPSKVKFKLRCHydrophilic
NLS Segment(s)
PositionSequence
25-32KKKNGPSK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences PKQIDDIKYFLEIARRKDAKCKYFKKKNGPSKVKFKLRCSKYLYTFVIEDAEKAEKLQKSLPPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.39
4 0.47
5 0.55
6 0.56
7 0.62
8 0.67
9 0.68
10 0.74
11 0.82
12 0.85
13 0.86
14 0.88
15 0.88
16 0.88
17 0.84
18 0.84
19 0.84
20 0.82
21 0.77
22 0.75
23 0.74
24 0.68
25 0.69
26 0.67
27 0.65
28 0.6
29 0.62
30 0.56
31 0.49
32 0.45
33 0.38
34 0.33
35 0.26
36 0.21
37 0.16
38 0.16
39 0.13
40 0.14
41 0.2
42 0.18
43 0.21
44 0.26