Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RK38

Protein Details
Accession A0A372RK38    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40QVQKIKLTDNRKTRRRQAKYCPDCKETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPLKSYEPKTHPYQVQKIKLTDNRKTRRRQAKYCPDCKETDDCIKHFSNKLNKIEEIINEFHKKCPKKTIEKCSIFNAKFTLNNVPCELEYDLSKFTLENLQKLVSFTTQNCNNSSDKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.71
4 0.67
5 0.68
6 0.68
7 0.68
8 0.66
9 0.67
10 0.69
11 0.71
12 0.77
13 0.79
14 0.82
15 0.84
16 0.84
17 0.85
18 0.86
19 0.88
20 0.88
21 0.85
22 0.77
23 0.7
24 0.64
25 0.58
26 0.52
27 0.51
28 0.46
29 0.4
30 0.4
31 0.4
32 0.39
33 0.36
34 0.38
35 0.38
36 0.41
37 0.45
38 0.43
39 0.42
40 0.41
41 0.39
42 0.33
43 0.28
44 0.22
45 0.21
46 0.22
47 0.22
48 0.23
49 0.29
50 0.31
51 0.29
52 0.37
53 0.41
54 0.48
55 0.57
56 0.64
57 0.68
58 0.71
59 0.71
60 0.68
61 0.7
62 0.59
63 0.51
64 0.43
65 0.34
66 0.3
67 0.3
68 0.33
69 0.26
70 0.27
71 0.27
72 0.27
73 0.25
74 0.26
75 0.25
76 0.16
77 0.16
78 0.16
79 0.15
80 0.14
81 0.14
82 0.11
83 0.11
84 0.19
85 0.19
86 0.19
87 0.21
88 0.22
89 0.23
90 0.24
91 0.24
92 0.19
93 0.21
94 0.2
95 0.27
96 0.33
97 0.35
98 0.36
99 0.37
100 0.37