Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q535

Protein Details
Accession A0A372Q535   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
134-157GRTLRKRTVTANKANKKARANKKRHydrophilic
NLS Segment(s)
PositionSequence
126-157KNETATRGGRTLRKRTVTANKANKKARANKKR
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MNGTLGSLPNSNRQIEPEIRGEKRPVEKNIEESGGDEEERKSEDEEAAAEIEIRDDSNSDIDEGLERQLLDLFRKRYKKSGEQVVQQEEKEKEVEEKEKIIEEKDKEIEEKDKEIEEKEKEIEEKKNETATRGGRTLRKRTVTANKANKKARANKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.37
4 0.38
5 0.42
6 0.42
7 0.45
8 0.45
9 0.45
10 0.5
11 0.53
12 0.5
13 0.51
14 0.51
15 0.53
16 0.53
17 0.49
18 0.4
19 0.33
20 0.31
21 0.24
22 0.21
23 0.17
24 0.14
25 0.13
26 0.14
27 0.14
28 0.12
29 0.12
30 0.12
31 0.11
32 0.11
33 0.11
34 0.1
35 0.09
36 0.08
37 0.07
38 0.07
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.08
56 0.08
57 0.1
58 0.15
59 0.18
60 0.24
61 0.3
62 0.31
63 0.36
64 0.42
65 0.47
66 0.48
67 0.55
68 0.53
69 0.54
70 0.57
71 0.56
72 0.52
73 0.44
74 0.42
75 0.32
76 0.29
77 0.23
78 0.19
79 0.16
80 0.17
81 0.2
82 0.17
83 0.18
84 0.17
85 0.2
86 0.2
87 0.2
88 0.22
89 0.21
90 0.24
91 0.24
92 0.25
93 0.23
94 0.25
95 0.28
96 0.25
97 0.26
98 0.23
99 0.23
100 0.23
101 0.24
102 0.28
103 0.25
104 0.25
105 0.25
106 0.26
107 0.27
108 0.3
109 0.35
110 0.34
111 0.36
112 0.36
113 0.42
114 0.4
115 0.4
116 0.42
117 0.4
118 0.4
119 0.39
120 0.41
121 0.42
122 0.49
123 0.56
124 0.58
125 0.59
126 0.56
127 0.61
128 0.67
129 0.69
130 0.71
131 0.73
132 0.74
133 0.78
134 0.83
135 0.81
136 0.79
137 0.81