Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RNV8

Protein Details
Accession A0A372RNV8   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-122LRSNEHSRYHHKEKRKQLIKNNNFDRNKRKBasic
NLS Segment(s)
PositionSequence
105-109EKRKQ
118-122RNKRK
Subcellular Location(s) mito 18.5, mito_nucl 13.833, nucl 8, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MIKFLSKLRVSCFYKANNKKFCPFLLSYTSNYSTVSNLKSQQQIQRTPSSVPAGTILKGLNFYKDGADPIALPDDEYPNWLWEILDKEKDEQLRSNEHSRYHHKEKRKQLIKNNNFDRNKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.69
4 0.69
5 0.69
6 0.7
7 0.67
8 0.61
9 0.56
10 0.48
11 0.43
12 0.41
13 0.39
14 0.37
15 0.39
16 0.39
17 0.33
18 0.32
19 0.27
20 0.22
21 0.22
22 0.21
23 0.19
24 0.19
25 0.23
26 0.26
27 0.3
28 0.34
29 0.37
30 0.4
31 0.41
32 0.43
33 0.41
34 0.38
35 0.37
36 0.34
37 0.28
38 0.23
39 0.21
40 0.17
41 0.15
42 0.16
43 0.12
44 0.09
45 0.11
46 0.11
47 0.1
48 0.09
49 0.09
50 0.09
51 0.09
52 0.1
53 0.08
54 0.09
55 0.07
56 0.07
57 0.09
58 0.08
59 0.08
60 0.08
61 0.1
62 0.09
63 0.11
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.14
71 0.16
72 0.2
73 0.2
74 0.21
75 0.25
76 0.28
77 0.28
78 0.28
79 0.28
80 0.31
81 0.35
82 0.41
83 0.41
84 0.42
85 0.47
86 0.5
87 0.56
88 0.6
89 0.63
90 0.66
91 0.72
92 0.79
93 0.83
94 0.85
95 0.84
96 0.84
97 0.88
98 0.88
99 0.89
100 0.88
101 0.87
102 0.85