Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RNR9

Protein Details
Accession A0A372RNR9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-133LAEAEKTARKQRKERKNRAKKFRGTKKTKASTKKEKBasic
NLS Segment(s)
PositionSequence
92-133RLVRQKLAEAEKTARKQRKERKNRAKKFRGTKKTKASTKKEK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSGTATIRTRNFITNRLLRRRQFVVDVLHPGRANVSKDELREKLATMYKCDKEIIFVFGFRTVFGGGRSTGFGLIYEDIEHAKKFEPKYRLVRQKLAEAEKTARKQRKERKNRAKKFRGTKKTKASTKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.45
4 0.54
5 0.6
6 0.66
7 0.61
8 0.65
9 0.64
10 0.58
11 0.53
12 0.48
13 0.45
14 0.4
15 0.44
16 0.39
17 0.38
18 0.35
19 0.31
20 0.29
21 0.27
22 0.25
23 0.19
24 0.24
25 0.23
26 0.25
27 0.3
28 0.28
29 0.28
30 0.27
31 0.25
32 0.25
33 0.28
34 0.27
35 0.27
36 0.33
37 0.3
38 0.31
39 0.31
40 0.26
41 0.23
42 0.23
43 0.22
44 0.16
45 0.15
46 0.14
47 0.15
48 0.15
49 0.12
50 0.11
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.08
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.14
73 0.16
74 0.23
75 0.27
76 0.33
77 0.43
78 0.52
79 0.61
80 0.61
81 0.66
82 0.61
83 0.64
84 0.64
85 0.6
86 0.52
87 0.46
88 0.46
89 0.47
90 0.51
91 0.53
92 0.54
93 0.56
94 0.63
95 0.7
96 0.75
97 0.79
98 0.84
99 0.86
100 0.9
101 0.94
102 0.95
103 0.95
104 0.94
105 0.93
106 0.93
107 0.93
108 0.91
109 0.9
110 0.9
111 0.9
112 0.9
113 0.89