Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RJ15

Protein Details
Accession A0A372RJ15    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTSRLKKLFVRRPKKRVYVSNGICHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MTSRLKKLFVRRPKKRVYVSNGICDNGTLREYLKENFENLTWNDKFNLAFQLHSNNVLVHQNTIKLADFGLSKRIEETSILLWDIYGGQPTFYGIPYDVDLATSILQGLRETPTHDTPKEFILNDSNFIALLGRFNFLEIGINVDKKKVFELYQKSANMRDLVGINRSNIVINMELEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.87
4 0.85
5 0.84
6 0.79
7 0.79
8 0.71
9 0.62
10 0.53
11 0.43
12 0.36
13 0.26
14 0.21
15 0.13
16 0.11
17 0.14
18 0.17
19 0.18
20 0.22
21 0.22
22 0.22
23 0.23
24 0.22
25 0.23
26 0.22
27 0.29
28 0.24
29 0.23
30 0.23
31 0.23
32 0.23
33 0.2
34 0.24
35 0.17
36 0.17
37 0.17
38 0.21
39 0.21
40 0.22
41 0.21
42 0.15
43 0.16
44 0.18
45 0.17
46 0.14
47 0.14
48 0.13
49 0.13
50 0.15
51 0.13
52 0.1
53 0.1
54 0.09
55 0.1
56 0.09
57 0.14
58 0.13
59 0.13
60 0.14
61 0.14
62 0.13
63 0.12
64 0.13
65 0.09
66 0.1
67 0.1
68 0.09
69 0.08
70 0.08
71 0.08
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.05
82 0.06
83 0.06
84 0.07
85 0.07
86 0.06
87 0.07
88 0.07
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.09
99 0.13
100 0.18
101 0.23
102 0.23
103 0.24
104 0.24
105 0.27
106 0.29
107 0.25
108 0.21
109 0.24
110 0.24
111 0.24
112 0.23
113 0.19
114 0.16
115 0.15
116 0.14
117 0.07
118 0.09
119 0.08
120 0.09
121 0.08
122 0.09
123 0.09
124 0.08
125 0.11
126 0.08
127 0.14
128 0.14
129 0.18
130 0.18
131 0.2
132 0.21
133 0.19
134 0.21
135 0.19
136 0.21
137 0.27
138 0.35
139 0.39
140 0.46
141 0.49
142 0.49
143 0.49
144 0.49
145 0.42
146 0.33
147 0.3
148 0.25
149 0.24
150 0.27
151 0.25
152 0.23
153 0.23
154 0.23
155 0.21
156 0.19
157 0.19
158 0.15