Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372Q217

Protein Details
Accession A0A372Q217    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
144-166ESKSNDNDNRPSKKRKVRRRQIDBasic
NLS Segment(s)
PositionSequence
153-163RPSKKRKVRRR
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MANVHFLKSSFEHTRTIKLQELSLSQMPHRDSLSREFLPYDFSLNPIKPSESLAYKYKNSDYKKLKREHSQLHDEHAYLQGRMCKVYRELKEIKGELYKFRQDYIKLHSHNKYINHENEVLRAKIDNLKSQISSQDDADVKSLESKSNDNDNRPSKKRKVRRRQID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.45
4 0.44
5 0.38
6 0.38
7 0.35
8 0.35
9 0.33
10 0.33
11 0.3
12 0.24
13 0.28
14 0.27
15 0.26
16 0.26
17 0.22
18 0.22
19 0.27
20 0.33
21 0.29
22 0.29
23 0.28
24 0.27
25 0.29
26 0.26
27 0.24
28 0.17
29 0.18
30 0.21
31 0.21
32 0.23
33 0.2
34 0.2
35 0.17
36 0.2
37 0.21
38 0.19
39 0.23
40 0.25
41 0.28
42 0.29
43 0.31
44 0.34
45 0.38
46 0.39
47 0.45
48 0.5
49 0.55
50 0.62
51 0.66
52 0.68
53 0.69
54 0.73
55 0.73
56 0.7
57 0.69
58 0.61
59 0.58
60 0.53
61 0.44
62 0.37
63 0.32
64 0.25
65 0.17
66 0.17
67 0.15
68 0.14
69 0.15
70 0.14
71 0.11
72 0.15
73 0.23
74 0.23
75 0.28
76 0.3
77 0.33
78 0.37
79 0.36
80 0.34
81 0.31
82 0.3
83 0.27
84 0.29
85 0.3
86 0.26
87 0.27
88 0.29
89 0.26
90 0.28
91 0.31
92 0.35
93 0.33
94 0.39
95 0.41
96 0.42
97 0.44
98 0.46
99 0.46
100 0.45
101 0.45
102 0.43
103 0.43
104 0.4
105 0.41
106 0.4
107 0.33
108 0.26
109 0.23
110 0.21
111 0.23
112 0.25
113 0.25
114 0.25
115 0.27
116 0.28
117 0.29
118 0.32
119 0.3
120 0.29
121 0.24
122 0.27
123 0.25
124 0.25
125 0.26
126 0.21
127 0.17
128 0.21
129 0.21
130 0.19
131 0.2
132 0.22
133 0.25
134 0.36
135 0.4
136 0.4
137 0.49
138 0.54
139 0.62
140 0.67
141 0.72
142 0.72
143 0.78
144 0.84
145 0.86
146 0.88