Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QH69

Protein Details
Accession A0A372QH69   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
129-152DVTYCKWNYYKKRIRDNGNNFSIEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006571  TLDc_dom  
Pfam View protein in Pfam  
PF07534  TLD  
PROSITE View protein in PROSITE  
PS51886  TLDC  
Amino Acid Sequences MVINDDNYKKPYLPYKFKLILRGSRDGFTPNKFHELCDGKSNTVTFIKVNGTEEILGGYNPLEWKTTGKWCKTNDSFIFSFKNRNIKDAILSNVINTNYALNYSSLCGPQFGLDLVVYSSKLNGRTNFDVTYCKWNYYKKRIRDNGNNFSIEDYEIFKIIRRQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.62
4 0.64
5 0.68
6 0.65
7 0.64
8 0.6
9 0.63
10 0.56
11 0.49
12 0.47
13 0.43
14 0.4
15 0.36
16 0.35
17 0.3
18 0.36
19 0.35
20 0.34
21 0.38
22 0.39
23 0.37
24 0.4
25 0.4
26 0.33
27 0.35
28 0.34
29 0.29
30 0.25
31 0.24
32 0.16
33 0.16
34 0.16
35 0.15
36 0.17
37 0.15
38 0.14
39 0.14
40 0.13
41 0.12
42 0.1
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.09
52 0.12
53 0.21
54 0.26
55 0.3
56 0.35
57 0.37
58 0.45
59 0.45
60 0.5
61 0.43
62 0.43
63 0.39
64 0.35
65 0.37
66 0.29
67 0.31
68 0.26
69 0.33
70 0.28
71 0.29
72 0.28
73 0.25
74 0.27
75 0.24
76 0.24
77 0.18
78 0.18
79 0.16
80 0.18
81 0.17
82 0.15
83 0.13
84 0.11
85 0.08
86 0.09
87 0.09
88 0.06
89 0.07
90 0.07
91 0.08
92 0.09
93 0.09
94 0.09
95 0.08
96 0.09
97 0.09
98 0.08
99 0.07
100 0.06
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.09
108 0.13
109 0.17
110 0.2
111 0.26
112 0.3
113 0.33
114 0.33
115 0.32
116 0.32
117 0.3
118 0.37
119 0.31
120 0.31
121 0.32
122 0.39
123 0.48
124 0.55
125 0.62
126 0.62
127 0.72
128 0.77
129 0.83
130 0.85
131 0.86
132 0.85
133 0.81
134 0.73
135 0.63
136 0.56
137 0.47
138 0.37
139 0.28
140 0.21
141 0.16
142 0.16
143 0.16
144 0.17