Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QG51

Protein Details
Accession A0A372QG51   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SKTSSTSTSKLKRRRSIGEEHydrophilic
141-166LEISNKTSEKKRKEFKAKIKNIFNNLHydrophilic
NLS Segment(s)
PositionSequence
150-156KKRKEFK
Subcellular Location(s) mito 15, mito_nucl 13.666, nucl 11, cyto_mito 8.666, cyto_nucl 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR006549  HAD-SF_hydro_IIIA  
IPR023214  HAD_sf  
IPR027417  P-loop_NTPase  
IPR013954  PNK3P  
IPR006551  Polynucleotide_phosphatase  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF13671  AAA_33  
PF08645  PNK3P  
Amino Acid Sequences MKKKGVKSTVVSSKTSSTSTSKLKRRRSIGEEEVSVSVKEAKLETTSEVFSIFKPQTDIQWREFDSVMIGQYLTSDIKKIEGRSKIGAFDLDCTLIIVNGTHKRSKDENDWKWRSKVIPKKLKQLYEEGYKIVIITNQGGLEISNKTSEKKRKEFKAKIKNIFNNLNVPCEIYVATARDKYRKPMIGIWKYITEHGNDGVITDMEESFYVGDAAGRGENWKPNAPRDWNDTDRKFAENIGIKFYTPEEFFENDKPAPYSYGDFNPKSLSQDVELFAPASPSLVPSDRHCEVIVFVGYPASGKSSFAEKWLISNGYVHVNQDKLKTKAKCIKSCEEALEKKKPVVIDNTNADVESRKAYIDLAKNYKVPVRCFWFQASEALAKHNNMYRAYGNIDGPRPLPEIAYSGFKSRFVEPKSEEGFDEIKKINFVFEGNDDEKRKWEMWYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.37
4 0.31
5 0.34
6 0.42
7 0.49
8 0.54
9 0.61
10 0.7
11 0.76
12 0.79
13 0.82
14 0.79
15 0.79
16 0.79
17 0.76
18 0.68
19 0.61
20 0.55
21 0.47
22 0.39
23 0.3
24 0.25
25 0.18
26 0.18
27 0.15
28 0.15
29 0.16
30 0.17
31 0.19
32 0.19
33 0.19
34 0.18
35 0.18
36 0.17
37 0.16
38 0.22
39 0.19
40 0.18
41 0.21
42 0.22
43 0.29
44 0.38
45 0.42
46 0.38
47 0.45
48 0.46
49 0.45
50 0.44
51 0.36
52 0.29
53 0.26
54 0.22
55 0.15
56 0.13
57 0.1
58 0.1
59 0.12
60 0.11
61 0.09
62 0.1
63 0.1
64 0.14
65 0.18
66 0.21
67 0.27
68 0.31
69 0.35
70 0.39
71 0.41
72 0.39
73 0.36
74 0.35
75 0.28
76 0.24
77 0.22
78 0.17
79 0.15
80 0.13
81 0.12
82 0.1
83 0.09
84 0.07
85 0.11
86 0.17
87 0.21
88 0.24
89 0.25
90 0.3
91 0.34
92 0.4
93 0.45
94 0.5
95 0.57
96 0.64
97 0.72
98 0.72
99 0.69
100 0.67
101 0.62
102 0.61
103 0.61
104 0.61
105 0.64
106 0.64
107 0.72
108 0.75
109 0.75
110 0.68
111 0.65
112 0.6
113 0.57
114 0.53
115 0.43
116 0.36
117 0.31
118 0.28
119 0.21
120 0.16
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.08
128 0.09
129 0.09
130 0.09
131 0.11
132 0.12
133 0.15
134 0.23
135 0.32
136 0.39
137 0.47
138 0.55
139 0.62
140 0.73
141 0.81
142 0.83
143 0.86
144 0.86
145 0.86
146 0.87
147 0.83
148 0.78
149 0.73
150 0.64
151 0.61
152 0.52
153 0.45
154 0.36
155 0.3
156 0.24
157 0.19
158 0.17
159 0.1
160 0.11
161 0.1
162 0.12
163 0.15
164 0.16
165 0.22
166 0.23
167 0.27
168 0.32
169 0.34
170 0.35
171 0.38
172 0.47
173 0.47
174 0.49
175 0.46
176 0.42
177 0.39
178 0.39
179 0.32
180 0.23
181 0.18
182 0.15
183 0.14
184 0.11
185 0.1
186 0.08
187 0.07
188 0.06
189 0.06
190 0.05
191 0.04
192 0.05
193 0.05
194 0.04
195 0.04
196 0.04
197 0.03
198 0.03
199 0.03
200 0.04
201 0.04
202 0.04
203 0.05
204 0.07
205 0.09
206 0.11
207 0.16
208 0.17
209 0.2
210 0.25
211 0.28
212 0.29
213 0.33
214 0.38
215 0.39
216 0.46
217 0.44
218 0.42
219 0.4
220 0.39
221 0.32
222 0.26
223 0.26
224 0.24
225 0.24
226 0.24
227 0.23
228 0.21
229 0.22
230 0.22
231 0.18
232 0.13
233 0.14
234 0.12
235 0.14
236 0.16
237 0.18
238 0.2
239 0.18
240 0.19
241 0.18
242 0.15
243 0.15
244 0.15
245 0.14
246 0.13
247 0.19
248 0.24
249 0.23
250 0.24
251 0.25
252 0.24
253 0.25
254 0.24
255 0.19
256 0.14
257 0.17
258 0.17
259 0.15
260 0.14
261 0.12
262 0.11
263 0.1
264 0.09
265 0.07
266 0.06
267 0.06
268 0.08
269 0.09
270 0.1
271 0.12
272 0.19
273 0.19
274 0.21
275 0.2
276 0.19
277 0.17
278 0.19
279 0.17
280 0.11
281 0.1
282 0.09
283 0.08
284 0.08
285 0.08
286 0.07
287 0.07
288 0.07
289 0.08
290 0.13
291 0.13
292 0.15
293 0.19
294 0.16
295 0.18
296 0.21
297 0.21
298 0.16
299 0.17
300 0.17
301 0.18
302 0.19
303 0.18
304 0.17
305 0.18
306 0.2
307 0.25
308 0.29
309 0.29
310 0.37
311 0.38
312 0.45
313 0.53
314 0.6
315 0.61
316 0.62
317 0.65
318 0.62
319 0.64
320 0.6
321 0.59
322 0.57
323 0.57
324 0.59
325 0.53
326 0.49
327 0.47
328 0.44
329 0.38
330 0.39
331 0.38
332 0.35
333 0.38
334 0.4
335 0.38
336 0.36
337 0.33
338 0.26
339 0.22
340 0.18
341 0.14
342 0.11
343 0.11
344 0.12
345 0.18
346 0.24
347 0.31
348 0.35
349 0.37
350 0.38
351 0.4
352 0.44
353 0.43
354 0.4
355 0.39
356 0.41
357 0.4
358 0.42
359 0.44
360 0.43
361 0.39
362 0.38
363 0.34
364 0.3
365 0.28
366 0.29
367 0.29
368 0.25
369 0.28
370 0.29
371 0.3
372 0.27
373 0.3
374 0.27
375 0.27
376 0.29
377 0.29
378 0.28
379 0.29
380 0.3
381 0.29
382 0.28
383 0.28
384 0.28
385 0.25
386 0.22
387 0.18
388 0.19
389 0.19
390 0.24
391 0.22
392 0.26
393 0.27
394 0.28
395 0.3
396 0.32
397 0.38
398 0.35
399 0.42
400 0.4
401 0.49
402 0.51
403 0.5
404 0.45
405 0.41
406 0.42
407 0.34
408 0.37
409 0.3
410 0.27
411 0.27
412 0.27
413 0.24
414 0.21
415 0.21
416 0.18
417 0.18
418 0.25
419 0.26
420 0.33
421 0.35
422 0.35
423 0.38
424 0.4
425 0.38