Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RGI0

Protein Details
Accession A0A372RGI0   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-86NEKIKEKPKKSSIRKVNPPRPIKKRPIBasic
90-114KVEPPPKVSSKRMKRIRNNLRIDMVHydrophilic
NLS Segment(s)
PositionSequence
62-106KIKEKPKKSSIRKVNPPRPIKKRPIEISKVEPPPKVSSKRMKRIR
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MNSLELFFQKLYKYEVAKKNNQENGHAQVVESPILDMNFDFSDAPPATVNEQKENGKDENEKIKEKPKKSSIRKVNPPRPIKKRPIEISKVEPPPKVSSKRMKRIRNNLRIDMVGYEQRHYAIRSNSTKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.44
3 0.5
4 0.57
5 0.64
6 0.69
7 0.71
8 0.67
9 0.62
10 0.58
11 0.55
12 0.51
13 0.42
14 0.32
15 0.28
16 0.28
17 0.23
18 0.18
19 0.13
20 0.1
21 0.1
22 0.1
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.07
29 0.13
30 0.13
31 0.14
32 0.12
33 0.13
34 0.15
35 0.18
36 0.19
37 0.17
38 0.2
39 0.21
40 0.21
41 0.25
42 0.23
43 0.22
44 0.23
45 0.24
46 0.3
47 0.32
48 0.33
49 0.31
50 0.39
51 0.44
52 0.45
53 0.49
54 0.49
55 0.56
56 0.62
57 0.71
58 0.72
59 0.74
60 0.82
61 0.85
62 0.85
63 0.84
64 0.85
65 0.84
66 0.82
67 0.81
68 0.8
69 0.77
70 0.77
71 0.76
72 0.75
73 0.72
74 0.68
75 0.66
76 0.65
77 0.66
78 0.6
79 0.53
80 0.48
81 0.48
82 0.51
83 0.5
84 0.49
85 0.52
86 0.59
87 0.68
88 0.74
89 0.78
90 0.81
91 0.86
92 0.9
93 0.89
94 0.87
95 0.82
96 0.76
97 0.66
98 0.57
99 0.48
100 0.41
101 0.37
102 0.3
103 0.25
104 0.22
105 0.23
106 0.24
107 0.24
108 0.26
109 0.26
110 0.34
111 0.42