Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R7Y3

Protein Details
Accession A0A372R7Y3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
177-196IYSTKTKNNKWECKRFYRIPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, nucl 9, mito 2, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
Amino Acid Sequences MSDNSVIEINDDIDKIDVDKIDVDKIDVDKIDVDKIDVDKNDDNIFTFDNEPHNGKPIARIEISPNEKYLITYSKEDCSIVGWDKDKGQPDVIVKINEDNKYGIESLCVFDDKKLAYNYKYDLINIIDLNNNGKKIALSFDVNVDPYYCTFNIKGEFILYSGVSNYFTDGNHKIIWIYSTKTKNNKWECKRFYRIPEDYELISISKYDKVYLFSNDSIYEWNINTEKSVKIFDNNKDKNKIETKNIRILSNEKFNILKVNDKIIVYSIELGITIASLDINDGNHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.11
5 0.11
6 0.14
7 0.15
8 0.18
9 0.18
10 0.17
11 0.18
12 0.19
13 0.21
14 0.18
15 0.18
16 0.18
17 0.19
18 0.21
19 0.18
20 0.18
21 0.18
22 0.2
23 0.23
24 0.21
25 0.25
26 0.25
27 0.27
28 0.28
29 0.25
30 0.25
31 0.21
32 0.22
33 0.19
34 0.18
35 0.17
36 0.19
37 0.22
38 0.23
39 0.22
40 0.26
41 0.25
42 0.23
43 0.28
44 0.28
45 0.3
46 0.28
47 0.28
48 0.29
49 0.37
50 0.42
51 0.37
52 0.34
53 0.3
54 0.29
55 0.29
56 0.27
57 0.22
58 0.2
59 0.23
60 0.24
61 0.25
62 0.26
63 0.25
64 0.22
65 0.19
66 0.19
67 0.18
68 0.19
69 0.18
70 0.19
71 0.21
72 0.25
73 0.27
74 0.25
75 0.23
76 0.23
77 0.23
78 0.27
79 0.27
80 0.25
81 0.22
82 0.25
83 0.29
84 0.26
85 0.26
86 0.21
87 0.18
88 0.19
89 0.19
90 0.15
91 0.11
92 0.1
93 0.1
94 0.1
95 0.11
96 0.09
97 0.09
98 0.11
99 0.11
100 0.14
101 0.16
102 0.17
103 0.18
104 0.2
105 0.21
106 0.23
107 0.23
108 0.19
109 0.18
110 0.17
111 0.17
112 0.14
113 0.13
114 0.11
115 0.11
116 0.14
117 0.13
118 0.12
119 0.11
120 0.11
121 0.1
122 0.09
123 0.11
124 0.09
125 0.09
126 0.1
127 0.12
128 0.12
129 0.13
130 0.12
131 0.11
132 0.09
133 0.08
134 0.11
135 0.09
136 0.1
137 0.1
138 0.11
139 0.12
140 0.12
141 0.12
142 0.1
143 0.1
144 0.09
145 0.09
146 0.07
147 0.06
148 0.06
149 0.06
150 0.07
151 0.06
152 0.07
153 0.07
154 0.07
155 0.11
156 0.12
157 0.14
158 0.13
159 0.13
160 0.13
161 0.12
162 0.14
163 0.11
164 0.12
165 0.18
166 0.24
167 0.3
168 0.37
169 0.41
170 0.5
171 0.59
172 0.66
173 0.69
174 0.73
175 0.75
176 0.77
177 0.8
178 0.77
179 0.74
180 0.74
181 0.68
182 0.61
183 0.58
184 0.51
185 0.43
186 0.37
187 0.3
188 0.21
189 0.17
190 0.14
191 0.11
192 0.12
193 0.12
194 0.13
195 0.13
196 0.16
197 0.18
198 0.22
199 0.25
200 0.22
201 0.23
202 0.22
203 0.22
204 0.21
205 0.19
206 0.17
207 0.13
208 0.16
209 0.15
210 0.15
211 0.16
212 0.16
213 0.17
214 0.16
215 0.2
216 0.17
217 0.23
218 0.3
219 0.37
220 0.46
221 0.52
222 0.58
223 0.62
224 0.63
225 0.64
226 0.66
227 0.64
228 0.63
229 0.65
230 0.64
231 0.66
232 0.68
233 0.61
234 0.55
235 0.54
236 0.51
237 0.5
238 0.44
239 0.38
240 0.36
241 0.35
242 0.39
243 0.36
244 0.37
245 0.3
246 0.35
247 0.36
248 0.35
249 0.35
250 0.3
251 0.29
252 0.23
253 0.22
254 0.16
255 0.12
256 0.12
257 0.12
258 0.09
259 0.07
260 0.06
261 0.04
262 0.04
263 0.04
264 0.05
265 0.06