Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QRH0

Protein Details
Accession A0A372QRH0   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-48INVNCKNKGKKVTQNKVNDNTHKDTRRKRITQNKKSNDDDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSIYFNQINVNCKNKGKKVTQNKVNDNTHKDTRRKRITQNKKSNDDDNHNTHKNACDTIELDISSDNEKAPANIERSSDNKKDASGNEQDSFRLLVNKSISEDGGGDSIRENNLQRYNSDDNYDDNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.61
4 0.66
5 0.72
6 0.78
7 0.8
8 0.82
9 0.83
10 0.84
11 0.83
12 0.8
13 0.76
14 0.72
15 0.71
16 0.7
17 0.69
18 0.69
19 0.72
20 0.75
21 0.75
22 0.78
23 0.8
24 0.84
25 0.86
26 0.88
27 0.87
28 0.84
29 0.81
30 0.78
31 0.73
32 0.69
33 0.64
34 0.6
35 0.58
36 0.53
37 0.49
38 0.43
39 0.4
40 0.34
41 0.29
42 0.22
43 0.16
44 0.14
45 0.16
46 0.15
47 0.12
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.07
54 0.07
55 0.07
56 0.07
57 0.09
58 0.11
59 0.13
60 0.14
61 0.15
62 0.17
63 0.21
64 0.27
65 0.27
66 0.27
67 0.25
68 0.24
69 0.27
70 0.26
71 0.28
72 0.27
73 0.29
74 0.29
75 0.29
76 0.28
77 0.25
78 0.25
79 0.2
80 0.19
81 0.15
82 0.17
83 0.19
84 0.2
85 0.21
86 0.21
87 0.2
88 0.16
89 0.17
90 0.13
91 0.13
92 0.12
93 0.1
94 0.09
95 0.11
96 0.12
97 0.14
98 0.15
99 0.19
100 0.26
101 0.27
102 0.27
103 0.33
104 0.38
105 0.37
106 0.4
107 0.34
108 0.31