Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QPE3

Protein Details
Accession A0A372QPE3    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
215-237MKERERAEKLRRRIEQNKIKVEEBasic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito_nucl 9.333, cyto_mito 8.833, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR038729  Rad50/SbcC_AAA  
Gene Ontology GO:0016887  F:ATP hydrolysis activity  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF13476  AAA_23  
Amino Acid Sequences MPKIHSIAIRGIRCFGPSQCFEVNLDQPLTLIVGTNGSGKTTIIEALRYATTGLCPPGTSRGKTFVMDPNLYGENEVKAQIKLEFTGIDGQEVVATRSMSMKQKKTVSTFQTLESLLEINDPASRFRTSLTGRCADLDSAVPAHLGVPPAILDFVIFCHQDDSLWPLSEPTVLKKKFDEIFESGKLSNIITDVKKDRKALATSYKEGKVVFDHLMKERERAEKLRRRIEQNKIKVEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.29
4 0.28
5 0.33
6 0.31
7 0.32
8 0.32
9 0.35
10 0.34
11 0.31
12 0.29
13 0.23
14 0.21
15 0.2
16 0.18
17 0.12
18 0.09
19 0.06
20 0.06
21 0.07
22 0.1
23 0.09
24 0.09
25 0.1
26 0.09
27 0.1
28 0.1
29 0.12
30 0.1
31 0.11
32 0.11
33 0.13
34 0.13
35 0.12
36 0.12
37 0.09
38 0.1
39 0.11
40 0.12
41 0.1
42 0.1
43 0.11
44 0.2
45 0.24
46 0.25
47 0.25
48 0.3
49 0.31
50 0.32
51 0.34
52 0.32
53 0.34
54 0.32
55 0.3
56 0.28
57 0.27
58 0.26
59 0.24
60 0.18
61 0.13
62 0.13
63 0.14
64 0.12
65 0.1
66 0.12
67 0.12
68 0.12
69 0.11
70 0.11
71 0.1
72 0.09
73 0.14
74 0.12
75 0.11
76 0.11
77 0.1
78 0.1
79 0.1
80 0.1
81 0.07
82 0.07
83 0.07
84 0.08
85 0.11
86 0.17
87 0.23
88 0.26
89 0.31
90 0.35
91 0.39
92 0.42
93 0.47
94 0.44
95 0.44
96 0.41
97 0.37
98 0.34
99 0.31
100 0.26
101 0.2
102 0.15
103 0.09
104 0.08
105 0.07
106 0.05
107 0.06
108 0.06
109 0.07
110 0.09
111 0.09
112 0.09
113 0.1
114 0.15
115 0.17
116 0.22
117 0.25
118 0.25
119 0.25
120 0.26
121 0.26
122 0.2
123 0.18
124 0.14
125 0.1
126 0.08
127 0.08
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.05
139 0.04
140 0.03
141 0.05
142 0.07
143 0.07
144 0.07
145 0.08
146 0.08
147 0.08
148 0.09
149 0.12
150 0.13
151 0.13
152 0.13
153 0.13
154 0.13
155 0.16
156 0.16
157 0.17
158 0.24
159 0.24
160 0.26
161 0.27
162 0.33
163 0.34
164 0.36
165 0.35
166 0.3
167 0.35
168 0.35
169 0.37
170 0.31
171 0.28
172 0.26
173 0.21
174 0.16
175 0.12
176 0.15
177 0.13
178 0.19
179 0.25
180 0.31
181 0.35
182 0.37
183 0.4
184 0.42
185 0.44
186 0.46
187 0.49
188 0.49
189 0.5
190 0.54
191 0.52
192 0.47
193 0.44
194 0.39
195 0.31
196 0.28
197 0.27
198 0.24
199 0.26
200 0.29
201 0.35
202 0.35
203 0.35
204 0.37
205 0.39
206 0.42
207 0.46
208 0.52
209 0.56
210 0.64
211 0.71
212 0.73
213 0.76
214 0.8
215 0.83
216 0.83
217 0.84
218 0.84