Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QLA9

Protein Details
Accession A0A372QLA9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-78KCSWCPYCSKYKRENLCRQILTKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025487  DUF4379  
Pfam View protein in Pfam  
PF14311  DUF4379  
Amino Acid Sequences MVSILCKHTLDDAKQIALTRDGKYLSTEYKNNKSPLLWICKNQHKWYAKFDNTVNKCSWCPYCSKYKRENLCRQILTKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.28
4 0.27
5 0.28
6 0.22
7 0.23
8 0.22
9 0.21
10 0.22
11 0.23
12 0.23
13 0.24
14 0.28
15 0.31
16 0.38
17 0.43
18 0.42
19 0.41
20 0.36
21 0.36
22 0.37
23 0.39
24 0.34
25 0.34
26 0.38
27 0.46
28 0.51
29 0.48
30 0.51
31 0.49
32 0.49
33 0.53
34 0.56
35 0.5
36 0.49
37 0.5
38 0.52
39 0.48
40 0.49
41 0.42
42 0.36
43 0.34
44 0.34
45 0.34
46 0.25
47 0.28
48 0.28
49 0.37
50 0.43
51 0.51
52 0.57
53 0.63
54 0.73
55 0.78
56 0.85
57 0.82
58 0.84
59 0.81