Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QF36

Protein Details
Accession A0A372QF36   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-121ESDANKSDQTQKKKSKLRNINTHKKGASHydrophilic
NLS Segment(s)
PositionSequence
105-123KKKSKLRNINTHKKGASRG
Subcellular Location(s) nucl 17, mito 5.5, cyto_mito 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MIELFLQSGADANSDNGRPLQLCVTNHDYEILDLLLEYGADVNCDGKFAIKIATDLGYKDMAKKLYRISNPTGEVVKGMVRRMSLLGRRRSNSESDANKSDQTQKKKSKLRNINTHKKGASRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.13
4 0.14
5 0.14
6 0.15
7 0.18
8 0.2
9 0.2
10 0.25
11 0.31
12 0.31
13 0.3
14 0.3
15 0.26
16 0.2
17 0.2
18 0.14
19 0.08
20 0.07
21 0.07
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.08
37 0.08
38 0.08
39 0.08
40 0.1
41 0.1
42 0.1
43 0.11
44 0.1
45 0.1
46 0.11
47 0.13
48 0.14
49 0.14
50 0.16
51 0.19
52 0.24
53 0.26
54 0.29
55 0.3
56 0.33
57 0.34
58 0.34
59 0.31
60 0.24
61 0.21
62 0.18
63 0.17
64 0.14
65 0.13
66 0.12
67 0.12
68 0.13
69 0.14
70 0.18
71 0.22
72 0.29
73 0.37
74 0.42
75 0.44
76 0.48
77 0.49
78 0.48
79 0.46
80 0.46
81 0.43
82 0.43
83 0.45
84 0.43
85 0.41
86 0.4
87 0.45
88 0.45
89 0.48
90 0.52
91 0.58
92 0.66
93 0.73
94 0.8
95 0.82
96 0.84
97 0.86
98 0.87
99 0.88
100 0.9
101 0.88
102 0.87
103 0.79