Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2Q7X6

Protein Details
Accession A2Q7X6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKQPKNLNLHRRRSRSEKYSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKQPKNLNLHRRRSRSEKYSPTGFEGSELGFLLHRFVGTSLEGWCWVGTGTGQDTWHENGGGDDDGDILLRIDPPTQNSSSFQHRTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.79
4 0.77
5 0.73
6 0.72
7 0.67
8 0.63
9 0.55
10 0.46
11 0.37
12 0.28
13 0.23
14 0.16
15 0.14
16 0.09
17 0.08
18 0.08
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.08
31 0.07
32 0.06
33 0.05
34 0.05
35 0.04
36 0.05
37 0.06
38 0.07
39 0.08
40 0.08
41 0.1
42 0.12
43 0.13
44 0.12
45 0.11
46 0.09
47 0.11
48 0.1
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.04
56 0.05
57 0.06
58 0.07
59 0.09
60 0.1
61 0.14
62 0.19
63 0.21
64 0.23
65 0.25
66 0.29
67 0.36