Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RPD1

Protein Details
Accession A0A372RPD1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-42PYVQKIRFENKIKKRKPPKICSDCKETSHydrophilic
NLS Segment(s)
PositionSequence
25-32KIKKRKPP
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSSKNYGQNTCGTPPYVQKIRFENKIKKRKPPKICSDCKETSDSVKLISSKANKAEEIIDDFYKNPIRKSKINQFSIFNARFTLNNASCELEYDLSKFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.41
4 0.38
5 0.39
6 0.45
7 0.5
8 0.57
9 0.61
10 0.63
11 0.66
12 0.75
13 0.76
14 0.78
15 0.83
16 0.84
17 0.86
18 0.85
19 0.86
20 0.86
21 0.89
22 0.83
23 0.81
24 0.74
25 0.65
26 0.58
27 0.48
28 0.41
29 0.34
30 0.3
31 0.22
32 0.21
33 0.18
34 0.16
35 0.19
36 0.18
37 0.18
38 0.21
39 0.22
40 0.2
41 0.2
42 0.21
43 0.18
44 0.18
45 0.18
46 0.15
47 0.14
48 0.15
49 0.17
50 0.21
51 0.21
52 0.21
53 0.26
54 0.31
55 0.37
56 0.45
57 0.53
58 0.57
59 0.63
60 0.63
61 0.58
62 0.59
63 0.63
64 0.56
65 0.45
66 0.37
67 0.31
68 0.29
69 0.29
70 0.33
71 0.25
72 0.26
73 0.27
74 0.28
75 0.27
76 0.29
77 0.28
78 0.2
79 0.19